Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D7BRY0

Protein Details
Accession A0A0D7BRY0    Localization Confidence Medium Confidence Score 10.1
NoLS Segment(s)
PositionSequenceProtein Nature
90-109RELRRAKKSKSQSRRFKGSNBasic
NLS Segment(s)
PositionSequence
93-105RRAKKSKSQSRRF
Subcellular Location(s) cysk 12, nucl 7, cyto_nucl 6.5, cyto 4, mito 2, pero 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR046528  DUF6593  
Pfam View protein in Pfam  
PF20236  DUF6593  
Amino Acid Sequences MAAEDITLCFAFPDPSEDMRTFKVYETQTASGQETELYRFSHPVTGLNSGLTSFYRRNPNTEIFEAAGSIEWFSNYSATVLFGLNQFHIRELRRAKKSKSQSRRFKGSNGIEYKWKIAEDDTGLVCVDATKGRTVAAYVQETSTLTVSRKLEETLDRVVVTCFLNLWVRSMGDW
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.18
3 0.23
4 0.24
5 0.26
6 0.28
7 0.3
8 0.27
9 0.24
10 0.29
11 0.25
12 0.29
13 0.32
14 0.31
15 0.31
16 0.32
17 0.33
18 0.25
19 0.24
20 0.21
21 0.16
22 0.16
23 0.15
24 0.15
25 0.14
26 0.15
27 0.16
28 0.18
29 0.17
30 0.19
31 0.19
32 0.21
33 0.21
34 0.2
35 0.19
36 0.15
37 0.15
38 0.12
39 0.13
40 0.12
41 0.17
42 0.26
43 0.27
44 0.31
45 0.34
46 0.39
47 0.41
48 0.41
49 0.37
50 0.28
51 0.28
52 0.23
53 0.19
54 0.14
55 0.08
56 0.07
57 0.05
58 0.04
59 0.05
60 0.05
61 0.05
62 0.05
63 0.05
64 0.05
65 0.05
66 0.06
67 0.06
68 0.06
69 0.07
70 0.07
71 0.07
72 0.09
73 0.08
74 0.09
75 0.11
76 0.12
77 0.17
78 0.24
79 0.32
80 0.39
81 0.45
82 0.48
83 0.54
84 0.64
85 0.69
86 0.72
87 0.74
88 0.76
89 0.79
90 0.84
91 0.77
92 0.7
93 0.69
94 0.64
95 0.62
96 0.56
97 0.5
98 0.45
99 0.44
100 0.42
101 0.34
102 0.28
103 0.19
104 0.16
105 0.17
106 0.14
107 0.16
108 0.14
109 0.14
110 0.13
111 0.13
112 0.12
113 0.09
114 0.08
115 0.07
116 0.08
117 0.09
118 0.09
119 0.09
120 0.1
121 0.11
122 0.13
123 0.17
124 0.18
125 0.18
126 0.18
127 0.19
128 0.19
129 0.19
130 0.17
131 0.13
132 0.11
133 0.17
134 0.17
135 0.18
136 0.2
137 0.2
138 0.22
139 0.24
140 0.27
141 0.26
142 0.27
143 0.25
144 0.24
145 0.23
146 0.22
147 0.19
148 0.16
149 0.12
150 0.12
151 0.18
152 0.17
153 0.2
154 0.19