Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D7AY27

Protein Details
Accession A0A0D7AY27    Localization Confidence Medium Confidence Score 11.3
NoLS Segment(s)
PositionSequenceProtein Nature
1-32MERMKRSTGLRCVRCRRKRLKCDHERPCKACIHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 17, mito 7, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR036864  Zn2-C6_fun-type_DNA-bd_sf  
IPR001138  Zn2Cys6_DnaBD  
Gene Ontology GO:0000981  F:DNA-binding transcription factor activity, RNA polymerase II-specific  
GO:0008270  F:zinc ion binding  
Pfam View protein in Pfam  
PF00172  Zn_clus  
PROSITE View protein in PROSITE  
PS00463  ZN2_CY6_FUNGAL_1  
PS50048  ZN2_CY6_FUNGAL_2  
Amino Acid Sequences MERMKRSTGLRCVRCRRKRLKCDHERPCKACITDKRRCVATQRRHTSETKSKKACDDCKRDKARCDSDFPCGRCIIKDRRCSNGEWPMEGSHDPLYKETPGVAYKWTHQGEPLEGYSDPRTG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.85
2 0.87
3 0.88
4 0.89
5 0.9
6 0.92
7 0.92
8 0.92
9 0.94
10 0.94
11 0.94
12 0.93
13 0.85
14 0.78
15 0.72
16 0.62
17 0.61
18 0.6
19 0.58
20 0.57
21 0.6
22 0.59
23 0.56
24 0.56
25 0.56
26 0.56
27 0.58
28 0.6
29 0.63
30 0.64
31 0.65
32 0.66
33 0.65
34 0.65
35 0.63
36 0.62
37 0.57
38 0.54
39 0.56
40 0.62
41 0.63
42 0.62
43 0.63
44 0.62
45 0.68
46 0.74
47 0.71
48 0.69
49 0.68
50 0.66
51 0.59
52 0.57
53 0.48
54 0.49
55 0.52
56 0.48
57 0.41
58 0.34
59 0.32
60 0.27
61 0.32
62 0.34
63 0.35
64 0.44
65 0.44
66 0.5
67 0.51
68 0.53
69 0.54
70 0.52
71 0.46
72 0.38
73 0.37
74 0.31
75 0.32
76 0.29
77 0.24
78 0.19
79 0.19
80 0.18
81 0.18
82 0.2
83 0.18
84 0.18
85 0.17
86 0.16
87 0.16
88 0.16
89 0.18
90 0.17
91 0.2
92 0.29
93 0.3
94 0.26
95 0.28
96 0.3
97 0.3
98 0.33
99 0.3
100 0.24
101 0.23
102 0.26