Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0D7BTD1

Protein Details
Accession A0A0D7BTD1    Localization Confidence Medium Confidence Score 12.1
NoLS Segment(s)
PositionSequenceProtein Nature
9-30STEKPAKKTKSGAKNGRKRLTPHydrophilic
NLS Segment(s)
PositionSequence
12-27KPAKKTKSGAKNGRKR
Subcellular Location(s) nucl 15.5, mito_nucl 13, mito 9.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR036910  HMG_box_dom_sf  
Amino Acid Sequences MAPATASSSTEKPAKKTKSGAKNGRKRLTPFNKFMQTEMAKLKETEPEKTHQQRFKQATANWKTSPINPKAVT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.43
2 0.45
3 0.52
4 0.58
5 0.62
6 0.7
7 0.76
8 0.77
9 0.81
10 0.85
11 0.83
12 0.79
13 0.72
14 0.73
15 0.73
16 0.69
17 0.64
18 0.62
19 0.62
20 0.57
21 0.54
22 0.5
23 0.4
24 0.36
25 0.34
26 0.28
27 0.22
28 0.22
29 0.22
30 0.21
31 0.22
32 0.24
33 0.24
34 0.26
35 0.35
36 0.43
37 0.51
38 0.51
39 0.55
40 0.6
41 0.63
42 0.64
43 0.63
44 0.57
45 0.6
46 0.6
47 0.62
48 0.53
49 0.53
50 0.49
51 0.48
52 0.54
53 0.48