Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D7B7G9

Protein Details
Accession A0A0D7B7G9    Localization Confidence Medium Confidence Score 13.9
NoLS Segment(s)
PositionSequenceProtein Nature
334-353AHAAKAKLRKERREEQERNVBasic
NLS Segment(s)
PositionSequence
322-361KKSKKEVNEQKAAHAAKAKLRKERREEQERNVAQKKKGKK
422-433PPPKKAKTRTKR
Subcellular Location(s) nucl 13, mito 12.5, cyto_mito 7.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR007109  Brix  
IPR045112  PPAN-like  
Gene Ontology GO:0016020  C:membrane  
GO:0019843  F:rRNA binding  
GO:0006364  P:rRNA processing  
Pfam View protein in Pfam  
PF04427  Brix  
PROSITE View protein in PROSITE  
PS50833  BRIX  
Amino Acid Sequences MARKRKNRTHLKGAAATDATQEGAPKSFVIKHGTVGPSLTHLVRDVRKVMEPNTASRLRERNRNKLKDYLVMAPALHVTHLLAFTLTPKAPSMRIVRLSDGPTLSFRVERYSLMKDILSQSKRSRSIGMEYLSPPLLVLASFPQPGPGVPAHLPLVMKAFQSLFPPLSPKTIKLSSARRVVLVSYNAEKGTIDWRHYVITIKSYGVSRRVRKLLEGPSKAAASTTKMLDLGNERDLADFLLRKKGEPGPDGYESASSAESVAGDENDQVDLADDYVGKNNKKGSRRAVRLDEVGPRMELKLVKITEGVPGKEGGVIYHSLVKKSKKEVNEQKAAHAAKAKLRKERREEQERNVAQKKKGKKVAFEEGDKMEGDEEDEEEEGEDGEGEDDGAWDDEEEIEDDEEEEEEDDIADQSSESEDERPPPKKAKTRTKR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.69
2 0.59
3 0.5
4 0.41
5 0.33
6 0.26
7 0.19
8 0.18
9 0.13
10 0.14
11 0.14
12 0.12
13 0.15
14 0.18
15 0.21
16 0.27
17 0.26
18 0.27
19 0.33
20 0.34
21 0.32
22 0.29
23 0.26
24 0.23
25 0.24
26 0.22
27 0.16
28 0.17
29 0.23
30 0.25
31 0.29
32 0.29
33 0.29
34 0.34
35 0.37
36 0.37
37 0.4
38 0.38
39 0.38
40 0.43
41 0.44
42 0.4
43 0.43
44 0.51
45 0.46
46 0.55
47 0.59
48 0.62
49 0.69
50 0.77
51 0.75
52 0.73
53 0.72
54 0.69
55 0.64
56 0.6
57 0.51
58 0.43
59 0.38
60 0.3
61 0.27
62 0.2
63 0.16
64 0.1
65 0.08
66 0.08
67 0.09
68 0.08
69 0.07
70 0.07
71 0.08
72 0.13
73 0.12
74 0.12
75 0.13
76 0.15
77 0.16
78 0.22
79 0.26
80 0.28
81 0.34
82 0.35
83 0.37
84 0.4
85 0.41
86 0.39
87 0.34
88 0.28
89 0.24
90 0.24
91 0.21
92 0.19
93 0.16
94 0.18
95 0.18
96 0.19
97 0.22
98 0.24
99 0.24
100 0.24
101 0.24
102 0.21
103 0.25
104 0.32
105 0.31
106 0.31
107 0.35
108 0.42
109 0.45
110 0.44
111 0.42
112 0.36
113 0.39
114 0.4
115 0.36
116 0.32
117 0.3
118 0.3
119 0.27
120 0.24
121 0.18
122 0.12
123 0.11
124 0.07
125 0.07
126 0.06
127 0.08
128 0.09
129 0.09
130 0.1
131 0.1
132 0.1
133 0.13
134 0.11
135 0.13
136 0.12
137 0.15
138 0.14
139 0.16
140 0.16
141 0.13
142 0.16
143 0.13
144 0.13
145 0.12
146 0.12
147 0.11
148 0.13
149 0.14
150 0.12
151 0.11
152 0.15
153 0.14
154 0.19
155 0.19
156 0.19
157 0.23
158 0.24
159 0.27
160 0.3
161 0.37
162 0.38
163 0.44
164 0.42
165 0.38
166 0.36
167 0.34
168 0.31
169 0.26
170 0.21
171 0.16
172 0.17
173 0.16
174 0.16
175 0.15
176 0.12
177 0.17
178 0.17
179 0.17
180 0.17
181 0.17
182 0.18
183 0.19
184 0.21
185 0.14
186 0.15
187 0.14
188 0.13
189 0.13
190 0.14
191 0.15
192 0.2
193 0.26
194 0.28
195 0.33
196 0.36
197 0.36
198 0.36
199 0.41
200 0.43
201 0.45
202 0.43
203 0.39
204 0.37
205 0.36
206 0.34
207 0.28
208 0.19
209 0.13
210 0.13
211 0.12
212 0.1
213 0.11
214 0.11
215 0.11
216 0.14
217 0.13
218 0.12
219 0.13
220 0.12
221 0.12
222 0.13
223 0.12
224 0.1
225 0.1
226 0.09
227 0.16
228 0.16
229 0.16
230 0.19
231 0.23
232 0.26
233 0.25
234 0.28
235 0.26
236 0.27
237 0.28
238 0.25
239 0.22
240 0.18
241 0.17
242 0.13
243 0.08
244 0.07
245 0.06
246 0.05
247 0.06
248 0.06
249 0.05
250 0.05
251 0.05
252 0.05
253 0.05
254 0.05
255 0.05
256 0.05
257 0.05
258 0.05
259 0.05
260 0.05
261 0.05
262 0.1
263 0.15
264 0.14
265 0.16
266 0.23
267 0.29
268 0.34
269 0.4
270 0.46
271 0.52
272 0.59
273 0.64
274 0.64
275 0.61
276 0.59
277 0.56
278 0.51
279 0.43
280 0.37
281 0.3
282 0.24
283 0.21
284 0.2
285 0.18
286 0.13
287 0.18
288 0.18
289 0.18
290 0.18
291 0.18
292 0.22
293 0.25
294 0.23
295 0.17
296 0.18
297 0.17
298 0.18
299 0.17
300 0.11
301 0.09
302 0.1
303 0.1
304 0.16
305 0.17
306 0.18
307 0.23
308 0.28
309 0.31
310 0.38
311 0.44
312 0.42
313 0.53
314 0.61
315 0.65
316 0.7
317 0.66
318 0.62
319 0.63
320 0.58
321 0.5
322 0.45
323 0.38
324 0.36
325 0.44
326 0.46
327 0.49
328 0.57
329 0.64
330 0.66
331 0.74
332 0.77
333 0.79
334 0.8
335 0.78
336 0.8
337 0.76
338 0.76
339 0.74
340 0.71
341 0.66
342 0.68
343 0.69
344 0.69
345 0.73
346 0.69
347 0.69
348 0.71
349 0.74
350 0.74
351 0.68
352 0.63
353 0.56
354 0.52
355 0.44
356 0.36
357 0.26
358 0.19
359 0.16
360 0.11
361 0.1
362 0.09
363 0.09
364 0.09
365 0.09
366 0.09
367 0.08
368 0.07
369 0.06
370 0.05
371 0.05
372 0.05
373 0.05
374 0.05
375 0.05
376 0.06
377 0.06
378 0.06
379 0.06
380 0.06
381 0.06
382 0.07
383 0.08
384 0.09
385 0.09
386 0.09
387 0.09
388 0.09
389 0.09
390 0.09
391 0.08
392 0.07
393 0.07
394 0.07
395 0.07
396 0.07
397 0.07
398 0.07
399 0.06
400 0.06
401 0.08
402 0.08
403 0.09
404 0.12
405 0.14
406 0.21
407 0.29
408 0.34
409 0.39
410 0.47
411 0.56
412 0.62
413 0.71