Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0D7AYN4

Protein Details
Accession A0A0D7AYN4    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
46-70SSSGGKSAKKKKWSKGKVKDKAQHAHydrophilic
NLS Segment(s)
PositionSequence
39-66AKAPPPSSSSGGKSAKKKKWSKGKVKDK
Subcellular Location(s) mito 25.5, cyto_mito 14
Family & Domain DBs
InterPro View protein in InterPro  
IPR004977  Ribosomal_S25  
IPR036390  WH_DNA-bd_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF03297  Ribosomal_S25  
Amino Acid Sequences MVSKILALSLSRRRTRCMQCARVLFGVVTTIPALDAAKAKAPPPSSSSGGKSAKKKKWSKGKVKDKAQHAVAVDKPMYDRILKEVPTFKFVSQSILIERLKVNGSLARVAIRHLEKEGLIKRIVHHSQQLVYTRSTASD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.55
2 0.63
3 0.66
4 0.68
5 0.67
6 0.68
7 0.72
8 0.71
9 0.63
10 0.55
11 0.44
12 0.33
13 0.26
14 0.18
15 0.13
16 0.09
17 0.07
18 0.06
19 0.07
20 0.07
21 0.06
22 0.08
23 0.08
24 0.12
25 0.13
26 0.13
27 0.17
28 0.19
29 0.2
30 0.22
31 0.26
32 0.26
33 0.28
34 0.3
35 0.34
36 0.38
37 0.41
38 0.46
39 0.52
40 0.55
41 0.62
42 0.67
43 0.68
44 0.73
45 0.78
46 0.81
47 0.82
48 0.86
49 0.86
50 0.88
51 0.86
52 0.8
53 0.75
54 0.65
55 0.56
56 0.46
57 0.39
58 0.3
59 0.26
60 0.21
61 0.15
62 0.14
63 0.13
64 0.13
65 0.11
66 0.1
67 0.12
68 0.15
69 0.16
70 0.19
71 0.24
72 0.24
73 0.27
74 0.28
75 0.24
76 0.25
77 0.24
78 0.25
79 0.2
80 0.2
81 0.18
82 0.22
83 0.22
84 0.2
85 0.2
86 0.18
87 0.18
88 0.17
89 0.16
90 0.13
91 0.14
92 0.14
93 0.15
94 0.15
95 0.14
96 0.15
97 0.2
98 0.19
99 0.19
100 0.19
101 0.2
102 0.19
103 0.27
104 0.3
105 0.27
106 0.27
107 0.27
108 0.28
109 0.36
110 0.39
111 0.36
112 0.37
113 0.38
114 0.39
115 0.43
116 0.46
117 0.4
118 0.37
119 0.35