Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0D7BP03

Protein Details
Accession A0A0D7BP03    Localization Confidence Low Confidence Score 8.8
NoLS Segment(s)
PositionSequenceProtein Nature
71-91AYRTLKREKLRQHQRHTYRGEBasic
NLS Segment(s)
Subcellular Location(s) nucl 10, cyto 8, mito_nucl 8
Family & Domain DBs
InterPro View protein in InterPro  
IPR013087  Znf_C2H2_type  
Amino Acid Sequences MAPIKKERMDTLVDINIQCDITKPPVDNNPTSKACPYPTCTFRAVRAWDLRTHSRAHTTSDALTCPHAGCAYRTLKREKLRQHQRHTYRGETLPVRVGRVYVSGSAERELEDACEDAYGRGAVSVPDMW
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.31
2 0.28
3 0.26
4 0.22
5 0.19
6 0.15
7 0.13
8 0.15
9 0.18
10 0.18
11 0.21
12 0.29
13 0.34
14 0.38
15 0.4
16 0.43
17 0.43
18 0.44
19 0.42
20 0.37
21 0.35
22 0.34
23 0.35
24 0.35
25 0.35
26 0.37
27 0.39
28 0.37
29 0.36
30 0.39
31 0.36
32 0.34
33 0.37
34 0.35
35 0.35
36 0.39
37 0.4
38 0.35
39 0.35
40 0.3
41 0.3
42 0.29
43 0.3
44 0.27
45 0.24
46 0.24
47 0.23
48 0.22
49 0.16
50 0.16
51 0.12
52 0.1
53 0.09
54 0.08
55 0.07
56 0.07
57 0.13
58 0.18
59 0.22
60 0.25
61 0.3
62 0.36
63 0.42
64 0.49
65 0.53
66 0.58
67 0.65
68 0.72
69 0.76
70 0.79
71 0.8
72 0.81
73 0.77
74 0.7
75 0.65
76 0.57
77 0.53
78 0.45
79 0.39
80 0.38
81 0.33
82 0.31
83 0.25
84 0.23
85 0.18
86 0.18
87 0.18
88 0.13
89 0.15
90 0.15
91 0.17
92 0.17
93 0.17
94 0.16
95 0.15
96 0.13
97 0.11
98 0.1
99 0.09
100 0.08
101 0.09
102 0.09
103 0.08
104 0.1
105 0.09
106 0.07
107 0.08
108 0.08
109 0.08