Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D7ARW3

Protein Details
Accession A0A0D7ARW3    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
26-45PSRWLWRRSRLGRHARRSRTBasic
NLS Segment(s)
Subcellular Location(s) extr 9, mito 8, cyto 4, plas 3, cyto_nucl 3
Family & Domain DBs
Amino Acid Sequences RPSNFALLSPVPSSLARIVALRVAVPSRWLWRRSRLGRHARRSRTYVVSSVRREWFAFGSRTTRRWRDHWSSSH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.16
3 0.13
4 0.13
5 0.13
6 0.12
7 0.12
8 0.1
9 0.1
10 0.1
11 0.09
12 0.1
13 0.11
14 0.16
15 0.21
16 0.25
17 0.27
18 0.34
19 0.43
20 0.49
21 0.56
22 0.6
23 0.66
24 0.72
25 0.79
26 0.81
27 0.78
28 0.75
29 0.71
30 0.66
31 0.6
32 0.53
33 0.48
34 0.46
35 0.47
36 0.46
37 0.47
38 0.45
39 0.41
40 0.39
41 0.35
42 0.32
43 0.28
44 0.27
45 0.24
46 0.3
47 0.32
48 0.36
49 0.43
50 0.48
51 0.49
52 0.52
53 0.59
54 0.61