Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A7TH30

Protein Details
Accession A7TH30   
Localization Confidence High
Confidence Score 16.4
NoLS Segment(s)
PositionSequenceProtein Nature
144-171KDNGISKQKVNKKSKPIKKVKLGNSSEDHydrophilic
NLS Segment(s)
PositionSequence
150-164KQKVNKKSKPIKKVK
Subcellular Location(s) nucl 21, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR040107  Snu23  
IPR036236  Znf_C2H2_sf  
IPR013087  Znf_C2H2_type  
Gene Ontology GO:0005681  C:spliceosomal complex  
GO:0046872  F:metal ion binding  
GO:0000398  P:mRNA splicing, via spliceosome  
KEGG vpo:Kpol_1032p79  -  
Pfam View protein in Pfam  
PF12874  zf-met  
PROSITE View protein in PROSITE  
PS00028  ZINC_FINGER_C2H2_1  
Amino Acid Sequences MSNFGRRTWDREEYARLAREGNDNSEEEKLRLSLTDEQLEQLKSMYSDHDSLLKSGLDDLNKKVLATGVTSYKKGKQFGFYCKLCNMTFKDNLQYIDHLNHKIHQIKFEAIFDEPLILDIRDNDEIGIEEFATTYKRLIKGFIKDNGISKQKVNKKSKPIKKVKLGNSSEDAELHKKMGFSSFGGGV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.56
2 0.53
3 0.46
4 0.4
5 0.37
6 0.4
7 0.36
8 0.34
9 0.3
10 0.28
11 0.29
12 0.32
13 0.31
14 0.24
15 0.23
16 0.19
17 0.16
18 0.15
19 0.17
20 0.2
21 0.23
22 0.25
23 0.24
24 0.25
25 0.28
26 0.27
27 0.24
28 0.17
29 0.14
30 0.11
31 0.11
32 0.12
33 0.12
34 0.12
35 0.13
36 0.18
37 0.18
38 0.17
39 0.19
40 0.16
41 0.14
42 0.15
43 0.16
44 0.14
45 0.15
46 0.17
47 0.21
48 0.21
49 0.2
50 0.18
51 0.17
52 0.15
53 0.14
54 0.15
55 0.17
56 0.18
57 0.2
58 0.22
59 0.26
60 0.29
61 0.31
62 0.3
63 0.31
64 0.35
65 0.42
66 0.48
67 0.44
68 0.42
69 0.4
70 0.42
71 0.34
72 0.34
73 0.28
74 0.25
75 0.27
76 0.25
77 0.28
78 0.26
79 0.27
80 0.24
81 0.21
82 0.18
83 0.18
84 0.19
85 0.18
86 0.16
87 0.16
88 0.2
89 0.26
90 0.25
91 0.25
92 0.25
93 0.25
94 0.26
95 0.25
96 0.22
97 0.15
98 0.15
99 0.12
100 0.11
101 0.08
102 0.08
103 0.08
104 0.06
105 0.06
106 0.06
107 0.09
108 0.09
109 0.09
110 0.08
111 0.08
112 0.08
113 0.09
114 0.09
115 0.06
116 0.05
117 0.05
118 0.06
119 0.07
120 0.07
121 0.07
122 0.11
123 0.14
124 0.15
125 0.19
126 0.25
127 0.3
128 0.37
129 0.41
130 0.42
131 0.41
132 0.45
133 0.47
134 0.47
135 0.41
136 0.39
137 0.43
138 0.47
139 0.55
140 0.61
141 0.62
142 0.68
143 0.78
144 0.83
145 0.85
146 0.87
147 0.87
148 0.88
149 0.89
150 0.88
151 0.87
152 0.81
153 0.76
154 0.7
155 0.62
156 0.53
157 0.45
158 0.39
159 0.32
160 0.3
161 0.25
162 0.22
163 0.2
164 0.2
165 0.22
166 0.2
167 0.18