Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D7B8I5

Protein Details
Accession A0A0D7B8I5    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
4-27ARHARLKCSRLRRRITASPRHGRTBasic
NLS Segment(s)
Subcellular Location(s) mito 17, nucl 9.5, cyto_nucl 5.5
Family & Domain DBs
Amino Acid Sequences MLVARHARLKCSRLRRRITASPRHGRTTIRRPALSPLDAGPPTKPPSPSNGSRTHTAWPLMPCLPSAREESRLMSTSASSAASRYSAFSPFLWFRCGIIR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.72
2 0.74
3 0.76
4 0.81
5 0.82
6 0.81
7 0.81
8 0.82
9 0.78
10 0.75
11 0.68
12 0.63
13 0.62
14 0.62
15 0.6
16 0.57
17 0.53
18 0.49
19 0.54
20 0.54
21 0.45
22 0.36
23 0.28
24 0.27
25 0.26
26 0.26
27 0.2
28 0.18
29 0.21
30 0.23
31 0.23
32 0.19
33 0.24
34 0.29
35 0.34
36 0.36
37 0.4
38 0.39
39 0.4
40 0.41
41 0.37
42 0.33
43 0.29
44 0.27
45 0.2
46 0.21
47 0.2
48 0.18
49 0.17
50 0.16
51 0.17
52 0.15
53 0.2
54 0.19
55 0.22
56 0.23
57 0.25
58 0.27
59 0.27
60 0.26
61 0.21
62 0.19
63 0.15
64 0.15
65 0.14
66 0.1
67 0.09
68 0.09
69 0.1
70 0.1
71 0.12
72 0.13
73 0.14
74 0.16
75 0.16
76 0.22
77 0.25
78 0.27
79 0.28
80 0.26