Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0D7B0V4

Protein Details
Accession A0A0D7B0V4    Localization Confidence Medium Confidence Score 11.8
NoLS Segment(s)
PositionSequenceProtein Nature
71-94QVSSLRYQNRRVKHGRKKVKKPKABasic
NLS Segment(s)
PositionSequence
80-94RRVKHGRKKVKKPKA
Subcellular Location(s) nucl 19, mito_nucl 13.333, cyto_nucl 10.833, mito 6.5
Family & Domain DBs
Amino Acid Sequences MQREHSEKVTSLSKRLFDADAINLQLEREISRLKLANAERLQEMVELGKKYDSLEANVAALRVHARIQHRQVSSLRYQNRRVKHGRKKVKKPKA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.35
2 0.36
3 0.32
4 0.25
5 0.26
6 0.23
7 0.21
8 0.2
9 0.19
10 0.16
11 0.15
12 0.14
13 0.12
14 0.1
15 0.09
16 0.09
17 0.09
18 0.12
19 0.14
20 0.14
21 0.2
22 0.2
23 0.27
24 0.27
25 0.28
26 0.25
27 0.24
28 0.24
29 0.17
30 0.16
31 0.09
32 0.11
33 0.09
34 0.09
35 0.09
36 0.09
37 0.09
38 0.13
39 0.12
40 0.11
41 0.12
42 0.12
43 0.13
44 0.13
45 0.12
46 0.08
47 0.08
48 0.07
49 0.06
50 0.07
51 0.11
52 0.15
53 0.22
54 0.28
55 0.35
56 0.35
57 0.39
58 0.41
59 0.43
60 0.45
61 0.47
62 0.5
63 0.49
64 0.58
65 0.61
66 0.65
67 0.69
68 0.72
69 0.74
70 0.77
71 0.82
72 0.84
73 0.87
74 0.92