Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D7BCB6

Protein Details
Accession A0A0D7BCB6    Localization Confidence Low Confidence Score 9.9
NoLS Segment(s)
PositionSequenceProtein Nature
103-130SRNPEETQSQHRQRRRRHLGFGHVQRFEHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 18.5, cyto_nucl 13, cyto 6.5
Family & Domain DBs
Amino Acid Sequences MDEATEAVVEGIRRTNDERRITGKEPEQPRIMFEILMEKGLMSREQVDKAIEEEGSNITFEHIEPTPGEPPKPVTGRSKDPIESLNTHTRAYQRCRRKVPASSRNPEETQSQHRQRRRRHLGFGHVQRFERCSRTLEETLPT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.27
3 0.35
4 0.4
5 0.43
6 0.45
7 0.52
8 0.52
9 0.55
10 0.53
11 0.53
12 0.53
13 0.54
14 0.53
15 0.46
16 0.45
17 0.42
18 0.37
19 0.28
20 0.23
21 0.23
22 0.18
23 0.19
24 0.16
25 0.12
26 0.12
27 0.13
28 0.13
29 0.07
30 0.1
31 0.12
32 0.13
33 0.15
34 0.15
35 0.14
36 0.15
37 0.15
38 0.12
39 0.09
40 0.09
41 0.09
42 0.08
43 0.08
44 0.07
45 0.06
46 0.06
47 0.06
48 0.08
49 0.07
50 0.08
51 0.08
52 0.1
53 0.14
54 0.15
55 0.15
56 0.13
57 0.15
58 0.19
59 0.2
60 0.21
61 0.24
62 0.27
63 0.33
64 0.36
65 0.37
66 0.33
67 0.33
68 0.32
69 0.29
70 0.28
71 0.27
72 0.31
73 0.29
74 0.29
75 0.29
76 0.32
77 0.34
78 0.39
79 0.43
80 0.46
81 0.53
82 0.6
83 0.66
84 0.68
85 0.72
86 0.75
87 0.77
88 0.76
89 0.75
90 0.73
91 0.72
92 0.66
93 0.58
94 0.51
95 0.46
96 0.45
97 0.47
98 0.52
99 0.55
100 0.62
101 0.69
102 0.75
103 0.81
104 0.83
105 0.81
106 0.81
107 0.8
108 0.82
109 0.84
110 0.84
111 0.81
112 0.75
113 0.69
114 0.61
115 0.58
116 0.52
117 0.46
118 0.38
119 0.33
120 0.34
121 0.39
122 0.4