Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D7B7E7

Protein Details
Accession A0A0D7B7E7   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
43-65TDTSRPRPFKRDLPRMRRKWPAVHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 21.5, cyto_mito 13, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR014807  Coa1  
IPR042432  Coa1_fungi  
Gene Ontology GO:0016020  C:membrane  
GO:0005739  C:mitochondrion  
GO:0033617  P:mitochondrial cytochrome c oxidase assembly  
Pfam View protein in Pfam  
PF08695  Coa1  
Amino Acid Sequences MNTLIRRVAFAPIARPRTLCAYSTYVRKPPPPPTEPPTVTMYTDTSRPRPFKRDLPRMRRKWPAVLAFGALGLSAWVAFYTFATNQGKITSSVVQQSLRTVKHDPGAQEVIGEAIRFEPEWWLNGDPWILGSVNMLQGHVDLSFRVKGTKGAGTVYFTSIRRDKGMSFEIVRFKLIADNGTVVQIDPATA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.39
2 0.39
3 0.37
4 0.4
5 0.41
6 0.33
7 0.29
8 0.31
9 0.33
10 0.41
11 0.44
12 0.43
13 0.45
14 0.5
15 0.52
16 0.56
17 0.61
18 0.59
19 0.6
20 0.59
21 0.65
22 0.6
23 0.58
24 0.53
25 0.45
26 0.4
27 0.35
28 0.32
29 0.23
30 0.27
31 0.27
32 0.28
33 0.33
34 0.38
35 0.42
36 0.45
37 0.49
38 0.54
39 0.61
40 0.66
41 0.7
42 0.75
43 0.81
44 0.82
45 0.84
46 0.84
47 0.77
48 0.73
49 0.69
50 0.63
51 0.55
52 0.48
53 0.42
54 0.32
55 0.28
56 0.21
57 0.13
58 0.08
59 0.04
60 0.03
61 0.02
62 0.02
63 0.02
64 0.02
65 0.03
66 0.03
67 0.05
68 0.05
69 0.1
70 0.12
71 0.12
72 0.13
73 0.13
74 0.14
75 0.13
76 0.15
77 0.12
78 0.11
79 0.13
80 0.14
81 0.14
82 0.13
83 0.15
84 0.17
85 0.16
86 0.18
87 0.18
88 0.18
89 0.2
90 0.23
91 0.21
92 0.21
93 0.22
94 0.19
95 0.17
96 0.15
97 0.13
98 0.11
99 0.1
100 0.06
101 0.04
102 0.05
103 0.05
104 0.05
105 0.07
106 0.07
107 0.08
108 0.11
109 0.12
110 0.12
111 0.12
112 0.12
113 0.1
114 0.09
115 0.1
116 0.07
117 0.06
118 0.07
119 0.07
120 0.1
121 0.1
122 0.1
123 0.09
124 0.09
125 0.09
126 0.09
127 0.08
128 0.05
129 0.08
130 0.09
131 0.1
132 0.11
133 0.11
134 0.13
135 0.16
136 0.19
137 0.18
138 0.19
139 0.2
140 0.22
141 0.23
142 0.23
143 0.24
144 0.22
145 0.27
146 0.28
147 0.29
148 0.28
149 0.29
150 0.27
151 0.29
152 0.32
153 0.31
154 0.31
155 0.34
156 0.38
157 0.37
158 0.37
159 0.31
160 0.28
161 0.27
162 0.25
163 0.21
164 0.16
165 0.18
166 0.17
167 0.18
168 0.18
169 0.14
170 0.13