Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0D7BIZ9

Protein Details
Accession A0A0D7BIZ9    Localization Confidence Low Confidence Score 8.4
NoLS Segment(s)
PositionSequenceProtein Nature
16-59LLHAHRSLCRRRRHERSLHRAILRVPRSRLRHRVHHRNHHQILRBasic
NLS Segment(s)
PositionSequence
25-50RRRRHERSLHRAILRVPRSRLRHRVH
Subcellular Location(s) mito 20, cyto 2, extr 2, nucl 1, plas 1, pero 1
Family & Domain DBs
Amino Acid Sequences MSHGSHLVLLLVRIRLLHAHRSLCRRRRHERSLHRAILRVPRSRLRHRVHHRNHHQILRVRLWERLLVRHDHVRQVHHGLHRVHVLQR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.14
3 0.17
4 0.23
5 0.25
6 0.31
7 0.36
8 0.45
9 0.54
10 0.58
11 0.65
12 0.66
13 0.71
14 0.75
15 0.8
16 0.81
17 0.82
18 0.84
19 0.84
20 0.82
21 0.74
22 0.66
23 0.6
24 0.59
25 0.53
26 0.48
27 0.42
28 0.42
29 0.48
30 0.52
31 0.58
32 0.54
33 0.59
34 0.64
35 0.71
36 0.73
37 0.78
38 0.8
39 0.81
40 0.82
41 0.76
42 0.74
43 0.68
44 0.65
45 0.59
46 0.56
47 0.46
48 0.43
49 0.39
50 0.36
51 0.33
52 0.33
53 0.31
54 0.29
55 0.32
56 0.38
57 0.39
58 0.42
59 0.43
60 0.41
61 0.43
62 0.45
63 0.47
64 0.44
65 0.49
66 0.43
67 0.44
68 0.45