Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D7BEH0

Protein Details
Accession A0A0D7BEH0   
Localization Confidence Medium
Confidence Score 13.8
NoLS Segment(s)
PositionSequenceProtein Nature
15-34SKSSKGFQKEDKPKEKRAPSBasic
NLS Segment(s)
PositionSequence
14-31ASKSSKGFQKEDKPKEKR
76-89PKRGQAPRKRAKKS
Subcellular Location(s) nucl 18, mito_nucl 12.499, cyto_nucl 11.833, mito 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR036910  HMG_box_dom_sf  
Amino Acid Sequences MPKAAPAKSVAKSASKSSKGFQKEDKPKEKRAPSAWNVYYTEHLPAWKANPANADKKIHAAMAEIAGLWRNDPANPKRGQAPRKRAKKSADGPPVDASSSAPSSSQSIADSDD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.47
2 0.46
3 0.46
4 0.45
5 0.51
6 0.51
7 0.53
8 0.53
9 0.55
10 0.6
11 0.69
12 0.75
13 0.72
14 0.76
15 0.81
16 0.79
17 0.76
18 0.72
19 0.71
20 0.65
21 0.69
22 0.62
23 0.56
24 0.51
25 0.44
26 0.39
27 0.3
28 0.28
29 0.18
30 0.16
31 0.13
32 0.13
33 0.13
34 0.15
35 0.15
36 0.14
37 0.18
38 0.22
39 0.26
40 0.28
41 0.29
42 0.25
43 0.27
44 0.26
45 0.22
46 0.18
47 0.14
48 0.11
49 0.09
50 0.08
51 0.06
52 0.05
53 0.06
54 0.06
55 0.06
56 0.06
57 0.06
58 0.07
59 0.15
60 0.18
61 0.25
62 0.26
63 0.28
64 0.35
65 0.43
66 0.51
67 0.54
68 0.62
69 0.65
70 0.74
71 0.79
72 0.78
73 0.76
74 0.77
75 0.75
76 0.75
77 0.74
78 0.67
79 0.64
80 0.6
81 0.55
82 0.45
83 0.37
84 0.28
85 0.22
86 0.2
87 0.17
88 0.14
89 0.14
90 0.16
91 0.17
92 0.17
93 0.14