Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D7BM34

Protein Details
Accession A0A0D7BM34   
Localization Confidence Medium
Confidence Score 11
NoLS Segment(s)
PositionSequenceProtein Nature
1-31MDVINKMFKRHDKKRARRSRSFPELRNKQGLHydrophilic
NLS Segment(s)
PositionSequence
9-21KRHDKKRARRSRS
Subcellular Location(s) mito 11, nucl 8, cyto_mito 8
Family & Domain DBs
Amino Acid Sequences MDVINKMFKRHDKKRARRSRSFPELRNKQGLSAPSPGGPAFLIDGPSASHKAAPTRQFEPNRYQSPKTAEPRRAVAHTPADHRYREHETNPVTAYHREAALNKLSGQAPPPKTKARSTQKHVPSPIKVPQDVPRDVYVREPVVFRPVEWNKSVPYNRINKYEGVSPKTLEW
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.87
2 0.91
3 0.91
4 0.91
5 0.9
6 0.9
7 0.9
8 0.88
9 0.85
10 0.85
11 0.84
12 0.8
13 0.79
14 0.69
15 0.6
16 0.55
17 0.51
18 0.43
19 0.38
20 0.33
21 0.25
22 0.26
23 0.23
24 0.2
25 0.17
26 0.13
27 0.1
28 0.1
29 0.1
30 0.08
31 0.09
32 0.09
33 0.11
34 0.12
35 0.11
36 0.12
37 0.11
38 0.16
39 0.22
40 0.27
41 0.29
42 0.32
43 0.4
44 0.44
45 0.46
46 0.5
47 0.52
48 0.55
49 0.55
50 0.52
51 0.48
52 0.5
53 0.55
54 0.55
55 0.55
56 0.52
57 0.5
58 0.52
59 0.51
60 0.46
61 0.39
62 0.35
63 0.33
64 0.3
65 0.31
66 0.32
67 0.32
68 0.3
69 0.29
70 0.3
71 0.3
72 0.3
73 0.28
74 0.29
75 0.28
76 0.29
77 0.29
78 0.26
79 0.22
80 0.2
81 0.21
82 0.16
83 0.15
84 0.14
85 0.14
86 0.15
87 0.16
88 0.16
89 0.14
90 0.16
91 0.15
92 0.15
93 0.17
94 0.22
95 0.23
96 0.27
97 0.31
98 0.35
99 0.38
100 0.43
101 0.5
102 0.53
103 0.58
104 0.62
105 0.67
106 0.7
107 0.74
108 0.76
109 0.72
110 0.65
111 0.61
112 0.61
113 0.56
114 0.49
115 0.44
116 0.46
117 0.47
118 0.44
119 0.42
120 0.38
121 0.35
122 0.34
123 0.35
124 0.31
125 0.26
126 0.26
127 0.24
128 0.21
129 0.26
130 0.25
131 0.22
132 0.28
133 0.31
134 0.34
135 0.36
136 0.37
137 0.33
138 0.42
139 0.45
140 0.4
141 0.43
142 0.48
143 0.51
144 0.55
145 0.55
146 0.48
147 0.48
148 0.51
149 0.5
150 0.46
151 0.44