Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0D7BTX7

Protein Details
Accession A0A0D7BTX7    Localization Confidence Medium Confidence Score 13
NoLS Segment(s)
PositionSequenceProtein Nature
82-120LDLRAKKTRAIRRRMTKHELSLKTAKQVKKEQNFPIRKYHydrophilic
NLS Segment(s)
PositionSequence
85-102RAKKTRAIRRRMTKHELS
Subcellular Location(s) nucl 20, cyto_nucl 14, cyto 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR001854  Ribosomal_L29/L35  
IPR036049  Ribosomal_L29/L35_sf  
IPR018254  Ribosomal_L29_CS  
IPR045059  RL35  
Gene Ontology GO:0022625  C:cytosolic large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0000463  P:maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00831  Ribosomal_L29  
PROSITE View protein in PROSITE  
PS00579  RIBOSOMAL_L29  
CDD cd00427  Ribosomal_L29_HIP  
Amino Acid Sequences MPGKVKAYELQSKSKNDLSKQLLELKNELLALRVQKIAGGSASKLTKINTVRKSIARVMTVMNHKARQNLREYYKTKKYLPLDLRAKKTRAIRRRMTKHELSLKTAKQVKKEQNFPIRKYAVKA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.56
2 0.55
3 0.48
4 0.53
5 0.5
6 0.49
7 0.48
8 0.53
9 0.5
10 0.47
11 0.46
12 0.37
13 0.33
14 0.28
15 0.24
16 0.16
17 0.15
18 0.14
19 0.14
20 0.14
21 0.12
22 0.12
23 0.13
24 0.12
25 0.11
26 0.1
27 0.09
28 0.12
29 0.13
30 0.13
31 0.14
32 0.14
33 0.19
34 0.23
35 0.32
36 0.32
37 0.36
38 0.39
39 0.39
40 0.43
41 0.41
42 0.39
43 0.31
44 0.27
45 0.23
46 0.25
47 0.26
48 0.26
49 0.23
50 0.23
51 0.23
52 0.28
53 0.3
54 0.28
55 0.3
56 0.33
57 0.36
58 0.42
59 0.44
60 0.46
61 0.52
62 0.54
63 0.5
64 0.52
65 0.49
66 0.5
67 0.53
68 0.55
69 0.56
70 0.58
71 0.65
72 0.63
73 0.61
74 0.57
75 0.61
76 0.62
77 0.61
78 0.63
79 0.65
80 0.7
81 0.78
82 0.82
83 0.81
84 0.77
85 0.77
86 0.78
87 0.71
88 0.67
89 0.66
90 0.58
91 0.59
92 0.6
93 0.54
94 0.52
95 0.58
96 0.62
97 0.63
98 0.7
99 0.72
100 0.75
101 0.8
102 0.76
103 0.77
104 0.71