Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0D7ATS2

Protein Details
Accession A0A0D7ATS2    Localization Confidence Medium Confidence Score 11.4
NoLS Segment(s)
PositionSequenceProtein Nature
9-35TQSCLNCHTSKRKCDRKRPCQRCIQLGHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 23.5, cyto_nucl 13
Family & Domain DBs
InterPro View protein in InterPro  
IPR036864  Zn2-C6_fun-type_DNA-bd_sf  
IPR001138  Zn2Cys6_DnaBD  
Gene Ontology GO:0000981  F:DNA-binding transcription factor activity, RNA polymerase II-specific  
GO:0008270  F:zinc ion binding  
Pfam View protein in Pfam  
PF00172  Zn_clus  
PROSITE View protein in PROSITE  
PS00463  ZN2_CY6_FUNGAL_1  
PS50048  ZN2_CY6_FUNGAL_2  
CDD cd00067  GAL4  
Amino Acid Sequences RKRRRNRTTQSCLNCHTSKRKCDRKRPCQRCIQLGLTGLCVYEIDDPALRNDPMIDETTRLRNRIAELESLVRELR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.67
2 0.63
3 0.63
4 0.61
5 0.62
6 0.66
7 0.73
8 0.75
9 0.83
10 0.88
11 0.88
12 0.92
13 0.91
14 0.88
15 0.88
16 0.83
17 0.79
18 0.73
19 0.65
20 0.56
21 0.5
22 0.42
23 0.32
24 0.27
25 0.2
26 0.14
27 0.1
28 0.08
29 0.06
30 0.06
31 0.06
32 0.07
33 0.08
34 0.1
35 0.12
36 0.11
37 0.1
38 0.1
39 0.11
40 0.12
41 0.14
42 0.13
43 0.12
44 0.15
45 0.24
46 0.27
47 0.27
48 0.26
49 0.26
50 0.29
51 0.33
52 0.33
53 0.26
54 0.27
55 0.3
56 0.3