Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

B2VYR9

Protein Details
Accession B2VYR9    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
43-66RGDAARRTSKPRKVLRKTNIKVLSHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 16, nucl 9.5, cyto_nucl 6
Family & Domain DBs
Amino Acid Sequences MGASQAAARGKVIPFRSDSRWRSSAITALSLLHSGLCMATRCRGDAARRTSKPRKVLRKTNIKVLSIFSTAEETDEA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.3
3 0.36
4 0.43
5 0.45
6 0.47
7 0.47
8 0.46
9 0.45
10 0.41
11 0.38
12 0.29
13 0.27
14 0.2
15 0.18
16 0.16
17 0.13
18 0.12
19 0.07
20 0.06
21 0.05
22 0.04
23 0.05
24 0.05
25 0.06
26 0.09
27 0.1
28 0.1
29 0.12
30 0.15
31 0.18
32 0.25
33 0.33
34 0.4
35 0.43
36 0.52
37 0.59
38 0.64
39 0.69
40 0.71
41 0.74
42 0.73
43 0.8
44 0.81
45 0.84
46 0.8
47 0.81
48 0.78
49 0.69
50 0.6
51 0.54
52 0.48
53 0.38
54 0.35
55 0.25
56 0.22
57 0.2