Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D7BUX3

Protein Details
Accession A0A0D7BUX3    Localization Confidence Medium Confidence Score 13.1
NoLS Segment(s)
PositionSequenceProtein Nature
1-22MGRLRRSRTHHARRDVHRGSRTBasic
74-96ALRSHWRSKVHRRRMKDLKVPAYHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 19, mito 4, cyto 4, cyto_mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR022755  Znf_C2H2_jaz  
IPR036236  Znf_C2H2_sf  
IPR013087  Znf_C2H2_type  
Gene Ontology GO:0046872  F:metal ion binding  
Pfam View protein in Pfam  
PF12171  zf-C2H2_jaz  
PROSITE View protein in PROSITE  
PS00028  ZINC_FINGER_C2H2_1  
PS50157  ZINC_FINGER_C2H2_2  
Amino Acid Sequences MGRLRRSRTHHARRDVHRGSRTRVRTRDLDQIQLIDLDPKNRAALEAQPLDFEAPGLAQHYCVECAKHYETDVALRSHWRSKVHRRRMKDLKVPAYTIEESERAAGLGRDTRRAVAPIA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.86
2 0.83
3 0.81
4 0.79
5 0.74
6 0.72
7 0.72
8 0.73
9 0.72
10 0.69
11 0.65
12 0.63
13 0.62
14 0.65
15 0.58
16 0.54
17 0.45
18 0.4
19 0.35
20 0.3
21 0.25
22 0.2
23 0.18
24 0.14
25 0.14
26 0.14
27 0.14
28 0.13
29 0.14
30 0.1
31 0.13
32 0.17
33 0.19
34 0.18
35 0.18
36 0.18
37 0.18
38 0.16
39 0.12
40 0.06
41 0.04
42 0.04
43 0.05
44 0.05
45 0.05
46 0.05
47 0.06
48 0.07
49 0.08
50 0.08
51 0.08
52 0.12
53 0.13
54 0.14
55 0.14
56 0.14
57 0.14
58 0.16
59 0.18
60 0.15
61 0.14
62 0.16
63 0.18
64 0.22
65 0.25
66 0.28
67 0.33
68 0.44
69 0.55
70 0.63
71 0.69
72 0.71
73 0.78
74 0.82
75 0.84
76 0.82
77 0.8
78 0.78
79 0.73
80 0.68
81 0.59
82 0.54
83 0.45
84 0.38
85 0.31
86 0.23
87 0.2
88 0.19
89 0.18
90 0.12
91 0.12
92 0.11
93 0.11
94 0.17
95 0.18
96 0.23
97 0.24
98 0.26
99 0.28