Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D7BNE2

Protein Details
Accession A0A0D7BNE2   
Localization Confidence Low
Confidence Score 8.7
NoLS Segment(s)
PositionSequenceProtein Nature
24-51SAPLARHNRPYRNQRRARRDNSRRTQDLHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 13.5, cyto_nucl 11.5, cyto 6.5, mito 5
Family & Domain DBs
Amino Acid Sequences MLLLDAGHFSRLNLFDTVMPRHISAPLARHNRPYRNQRRARRDNSRRTQDLERVLASIDSKIADAQETGVILKAELAQWKKRADDLEKQVIAKAIARGTA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.19
3 0.22
4 0.25
5 0.23
6 0.23
7 0.21
8 0.22
9 0.22
10 0.2
11 0.19
12 0.21
13 0.27
14 0.33
15 0.34
16 0.42
17 0.48
18 0.54
19 0.6
20 0.66
21 0.68
22 0.71
23 0.8
24 0.81
25 0.84
26 0.87
27 0.88
28 0.88
29 0.87
30 0.87
31 0.87
32 0.86
33 0.77
34 0.71
35 0.66
36 0.6
37 0.54
38 0.45
39 0.35
40 0.27
41 0.25
42 0.2
43 0.16
44 0.11
45 0.08
46 0.06
47 0.06
48 0.06
49 0.06
50 0.06
51 0.05
52 0.06
53 0.06
54 0.06
55 0.06
56 0.07
57 0.07
58 0.06
59 0.07
60 0.07
61 0.08
62 0.13
63 0.17
64 0.21
65 0.26
66 0.29
67 0.29
68 0.32
69 0.37
70 0.37
71 0.43
72 0.47
73 0.52
74 0.52
75 0.51
76 0.49
77 0.45
78 0.4
79 0.33
80 0.29