Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D7B4M5

Protein Details
Accession A0A0D7B4M5    Localization Confidence Medium Confidence Score 14.4
NoLS Segment(s)
PositionSequenceProtein Nature
19-61DSDSGREYKKDKKDKPKKDKKDKKDKKDKKEKKDKGKHGGGGGBasic
NLS Segment(s)
PositionSequence
27-57KKDKKDKPKKDKKDKKDKKDKKEKKDKGKHG
Subcellular Location(s) nucl 24, cyto_nucl 13.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR006616  DM9_repeat  
Pfam View protein in Pfam  
PF11901  DUF3421  
Amino Acid Sequences MSPHNRRRSVDSSSSDSSDSDSGREYKKDKKDKPKKDKKDKKDKKDKKEKKDKGKHGGGGGDYIHSTPQVPMEMPSHRAPVSIPASAAFASGPAGPAPSSGYRLPLHGTATFPEAYVAGQPPCHDVDGSPVYFGSALFEKSVQPCKVGPHLSGLCSVAYGGAEIAHTGRFDLLPFDPATMELVRASGGNLPPRRFVEGGYEESGSPLYHGIAVVNGLRIPGKVGTHLGACHVSFGGQEHTLQDYEIL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.55
2 0.48
3 0.42
4 0.36
5 0.3
6 0.25
7 0.19
8 0.18
9 0.21
10 0.24
11 0.29
12 0.3
13 0.37
14 0.47
15 0.57
16 0.63
17 0.7
18 0.78
19 0.84
20 0.92
21 0.94
22 0.94
23 0.95
24 0.96
25 0.96
26 0.96
27 0.96
28 0.96
29 0.96
30 0.95
31 0.95
32 0.95
33 0.95
34 0.95
35 0.95
36 0.94
37 0.94
38 0.94
39 0.93
40 0.92
41 0.9
42 0.83
43 0.75
44 0.68
45 0.57
46 0.49
47 0.39
48 0.29
49 0.21
50 0.17
51 0.13
52 0.09
53 0.09
54 0.08
55 0.09
56 0.09
57 0.09
58 0.11
59 0.14
60 0.15
61 0.19
62 0.2
63 0.21
64 0.2
65 0.2
66 0.18
67 0.22
68 0.23
69 0.2
70 0.18
71 0.16
72 0.17
73 0.17
74 0.16
75 0.09
76 0.06
77 0.06
78 0.06
79 0.06
80 0.05
81 0.05
82 0.05
83 0.06
84 0.08
85 0.08
86 0.11
87 0.11
88 0.14
89 0.14
90 0.15
91 0.17
92 0.16
93 0.17
94 0.15
95 0.15
96 0.12
97 0.14
98 0.13
99 0.12
100 0.1
101 0.09
102 0.08
103 0.08
104 0.09
105 0.07
106 0.07
107 0.07
108 0.09
109 0.09
110 0.1
111 0.09
112 0.07
113 0.12
114 0.15
115 0.14
116 0.13
117 0.12
118 0.11
119 0.12
120 0.11
121 0.08
122 0.06
123 0.06
124 0.06
125 0.07
126 0.08
127 0.11
128 0.18
129 0.17
130 0.18
131 0.18
132 0.21
133 0.26
134 0.26
135 0.24
136 0.24
137 0.25
138 0.24
139 0.25
140 0.22
141 0.17
142 0.15
143 0.14
144 0.07
145 0.06
146 0.05
147 0.04
148 0.03
149 0.03
150 0.04
151 0.04
152 0.05
153 0.05
154 0.05
155 0.05
156 0.05
157 0.06
158 0.08
159 0.08
160 0.1
161 0.11
162 0.11
163 0.1
164 0.11
165 0.13
166 0.1
167 0.11
168 0.08
169 0.08
170 0.08
171 0.08
172 0.08
173 0.1
174 0.12
175 0.2
176 0.25
177 0.26
178 0.3
179 0.32
180 0.36
181 0.32
182 0.31
183 0.31
184 0.31
185 0.33
186 0.31
187 0.3
188 0.26
189 0.26
190 0.26
191 0.17
192 0.13
193 0.09
194 0.07
195 0.07
196 0.07
197 0.07
198 0.06
199 0.08
200 0.08
201 0.09
202 0.08
203 0.09
204 0.09
205 0.09
206 0.11
207 0.12
208 0.12
209 0.14
210 0.16
211 0.17
212 0.18
213 0.19
214 0.2
215 0.2
216 0.19
217 0.18
218 0.16
219 0.14
220 0.13
221 0.15
222 0.16
223 0.14
224 0.15
225 0.15
226 0.18
227 0.18