Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

W6YU28

Protein Details
Accession W6YU28    Localization Confidence Medium Confidence Score 11.4
NoLS Segment(s)
PositionSequenceProtein Nature
62-95KSLSKLEGKKNKKQERRERRKKRHDERRVVSREVBasic
NLS Segment(s)
PositionSequence
65-93SKLEGKKNKKQERRERRKKRHDERRVVSR
Subcellular Location(s) mito 13.5, nucl 11, cyto_mito 7.5
Family & Domain DBs
KEGG bze:COCCADRAFT_21676  -  
Amino Acid Sequences MSNLRLSPERSSFSLSAHTTANAFFLMRRPIATPAPNLLTANAHDLWCPYSIPQPSHSHHAKSLSKLEGKKNKKQERRERRKKRHDERRVVSREVGKGSRWGPDGPFLPLGL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.36
2 0.32
3 0.29
4 0.26
5 0.25
6 0.19
7 0.18
8 0.18
9 0.11
10 0.1
11 0.09
12 0.11
13 0.15
14 0.14
15 0.15
16 0.16
17 0.19
18 0.24
19 0.25
20 0.23
21 0.23
22 0.25
23 0.25
24 0.23
25 0.2
26 0.17
27 0.15
28 0.17
29 0.15
30 0.12
31 0.11
32 0.12
33 0.12
34 0.12
35 0.11
36 0.08
37 0.12
38 0.15
39 0.16
40 0.2
41 0.24
42 0.25
43 0.31
44 0.33
45 0.29
46 0.29
47 0.35
48 0.33
49 0.31
50 0.34
51 0.32
52 0.35
53 0.37
54 0.44
55 0.47
56 0.51
57 0.56
58 0.63
59 0.69
60 0.73
61 0.8
62 0.82
63 0.84
64 0.89
65 0.92
66 0.93
67 0.94
68 0.96
69 0.96
70 0.96
71 0.96
72 0.96
73 0.95
74 0.92
75 0.92
76 0.86
77 0.79
78 0.73
79 0.67
80 0.61
81 0.55
82 0.49
83 0.4
84 0.39
85 0.37
86 0.37
87 0.34
88 0.31
89 0.27
90 0.32
91 0.32
92 0.31