Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

W6Y5I6

Protein Details
Accession W6Y5I6    Localization Confidence Medium Confidence Score 12.7
NoLS Segment(s)
PositionSequenceProtein Nature
29-57AQTTRTREERKEKKRKKSQVRESRPVLKNBasic
NLS Segment(s)
PositionSequence
35-49REERKEKKRKKSQVR
Subcellular Location(s) nucl 15, mito 10.5, cyto_mito 6.5
Family & Domain DBs
KEGG bze:COCCADRAFT_37189  -  
Amino Acid Sequences MALHAIVVLTASLRDAKRRDWHRNAQLTAQTTRTREERKEKKRKKSQVRESRPVLKNTNENESRGYEWPTRKTPSSTAPQRHTLNVCEY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.19
3 0.26
4 0.35
5 0.45
6 0.54
7 0.58
8 0.68
9 0.72
10 0.78
11 0.74
12 0.69
13 0.65
14 0.58
15 0.51
16 0.45
17 0.38
18 0.31
19 0.31
20 0.32
21 0.32
22 0.34
23 0.43
24 0.49
25 0.57
26 0.68
27 0.74
28 0.8
29 0.86
30 0.9
31 0.91
32 0.91
33 0.91
34 0.91
35 0.91
36 0.88
37 0.84
38 0.84
39 0.77
40 0.71
41 0.63
42 0.56
43 0.53
44 0.47
45 0.51
46 0.42
47 0.39
48 0.36
49 0.35
50 0.34
51 0.29
52 0.31
53 0.29
54 0.32
55 0.37
56 0.41
57 0.43
58 0.43
59 0.45
60 0.45
61 0.46
62 0.51
63 0.55
64 0.59
65 0.59
66 0.64
67 0.63
68 0.65
69 0.61