Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

W6Y5U1

Protein Details
Accession W6Y5U1    Localization Confidence Medium Confidence Score 13.4
NoLS Segment(s)
PositionSequenceProtein Nature
70-89KACSRRSTACHELRRRRWPLHydrophilic
NLS Segment(s)
PositionSequence
84-101RRRWPLGARGADGGQRKR
Subcellular Location(s) nucl 14, mito 7, cyto 5
Family & Domain DBs
KEGG bze:COCCADRAFT_103614  -  
Amino Acid Sequences MTVAGLGSQRGWKEMEGSGAARPAADGSDESAIRGHRLQGRHVVGVGAARTVGQQDGDPVMYQRRRAGTKACSRRSTACHELRRRRWPLGARGADGGQRKRGSRIPTAFTLTT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.19
3 0.18
4 0.19
5 0.18
6 0.19
7 0.18
8 0.15
9 0.14
10 0.11
11 0.09
12 0.08
13 0.07
14 0.07
15 0.11
16 0.11
17 0.11
18 0.13
19 0.13
20 0.13
21 0.14
22 0.16
23 0.17
24 0.19
25 0.21
26 0.27
27 0.29
28 0.28
29 0.28
30 0.23
31 0.19
32 0.19
33 0.16
34 0.08
35 0.06
36 0.05
37 0.05
38 0.05
39 0.05
40 0.04
41 0.04
42 0.05
43 0.06
44 0.06
45 0.06
46 0.06
47 0.12
48 0.13
49 0.14
50 0.16
51 0.2
52 0.22
53 0.24
54 0.29
55 0.32
56 0.41
57 0.5
58 0.54
59 0.53
60 0.54
61 0.57
62 0.56
63 0.56
64 0.55
65 0.54
66 0.57
67 0.64
68 0.71
69 0.75
70 0.81
71 0.78
72 0.73
73 0.72
74 0.69
75 0.68
76 0.69
77 0.63
78 0.55
79 0.52
80 0.49
81 0.46
82 0.46
83 0.4
84 0.37
85 0.37
86 0.37
87 0.4
88 0.45
89 0.45
90 0.49
91 0.52
92 0.5
93 0.51