Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

W6YG30

Protein Details
Accession W6YG30    Localization Confidence Medium Confidence Score 13.6
NoLS Segment(s)
PositionSequenceProtein Nature
1-20MPISKKDRIQREHRKAEKAGBasic
NLS Segment(s)
PositionSequence
8-26RIQREHRKAEKAGTRAPVK
Subcellular Location(s) nucl 20.5, cyto_nucl 12, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR026939  ZNF706/At2g23090_sf  
KEGG bze:COCCADRAFT_35889  -  
Amino Acid Sequences MPISKKDRIQREHRKAEKAGTRAPVKANGLPVKAPKPTSICQNCRREIVNTNKAQLEAHAASHDSVAWPKEKCWPNDF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.82
2 0.75
3 0.75
4 0.72
5 0.65
6 0.6
7 0.56
8 0.52
9 0.47
10 0.47
11 0.43
12 0.38
13 0.35
14 0.36
15 0.32
16 0.3
17 0.29
18 0.3
19 0.28
20 0.28
21 0.27
22 0.23
23 0.25
24 0.25
25 0.33
26 0.38
27 0.42
28 0.49
29 0.55
30 0.54
31 0.52
32 0.52
33 0.45
34 0.45
35 0.48
36 0.48
37 0.43
38 0.44
39 0.42
40 0.41
41 0.37
42 0.3
43 0.26
44 0.18
45 0.17
46 0.15
47 0.15
48 0.15
49 0.15
50 0.15
51 0.1
52 0.11
53 0.13
54 0.16
55 0.16
56 0.18
57 0.27
58 0.34