Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

W6YED9

Protein Details
Accession W6YED9   
Localization Confidence High
Confidence Score 19.6
NoLS Segment(s)
PositionSequenceProtein Nature
5-33GAAPAQHKQPSRKGKKAWRKNVDVTQIQSHydrophilic
259-299SDNENKEVKKKRPERKTISQRNKIKKRKEAERKAKHEAKMKBasic
NLS Segment(s)
PositionSequence
14-23PSRKGKKAWR
107-111KRKKA
162-191KKKPKVEPKTLKHAPISQAKTGKPIPAVRK
266-302VKKKRPERKTISQRNKIKKRKEAERKAKHEAKMKAKE
Subcellular Location(s) nucl 20.5, cyto_nucl 12.5, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR011687  Nop53/GLTSCR2  
Gene Ontology GO:0005730  C:nucleolus  
GO:0005654  C:nucleoplasm  
GO:0000027  P:ribosomal large subunit assembly  
KEGG bze:COCCADRAFT_89250  -  
Pfam View protein in Pfam  
PF07767  Nop53  
Amino Acid Sequences MADSGAAPAQHKQPSRKGKKAWRKNVDVTQIQSGLEEVREQIIQGGVIAEKPADELFAVDTLGSAEIKKSIAKRHKPLKVDEILAQRSAVPAVSTRKRLSDIADDGKRKKAKVSSKEYDRLRAIAYGGEQVKKDVVQTSDAVYDPWAVQEVKEDPRFEYLEKKKPKVEPKTLKHAPISQAKTGKPIPAVRKPTGGKSYNPLLEDWQNELMRESDKVVEAEKKRLEEAREEAERMERAAAETESDSGEESVWESEWEGFSDNENKEVKKKRPERKTISQRNKIKKRKEAERKAKHEAKMKAKEQQLQEVKRLAKSVEEKEKARAAVRQALEKQNAEAVEDDGEEIELRKKQFGKAPLPEAPLEVVLPDELRDSLRLLKPEGNLLKDRFRTMLLQGKVEARRQIPYAKQKKYTVSEKWSYKDWQLPK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.6
2 0.69
3 0.74
4 0.78
5 0.82
6 0.87
7 0.91
8 0.92
9 0.91
10 0.9
11 0.89
12 0.88
13 0.86
14 0.8
15 0.73
16 0.68
17 0.59
18 0.5
19 0.41
20 0.32
21 0.24
22 0.19
23 0.16
24 0.1
25 0.11
26 0.11
27 0.11
28 0.12
29 0.11
30 0.1
31 0.1
32 0.1
33 0.08
34 0.08
35 0.09
36 0.07
37 0.06
38 0.08
39 0.07
40 0.07
41 0.06
42 0.07
43 0.08
44 0.08
45 0.08
46 0.07
47 0.07
48 0.07
49 0.08
50 0.07
51 0.06
52 0.07
53 0.08
54 0.09
55 0.13
56 0.16
57 0.26
58 0.36
59 0.45
60 0.55
61 0.64
62 0.71
63 0.72
64 0.75
65 0.74
66 0.69
67 0.63
68 0.59
69 0.57
70 0.51
71 0.46
72 0.4
73 0.31
74 0.26
75 0.23
76 0.17
77 0.09
78 0.11
79 0.19
80 0.24
81 0.3
82 0.31
83 0.33
84 0.36
85 0.36
86 0.36
87 0.36
88 0.37
89 0.4
90 0.46
91 0.49
92 0.48
93 0.56
94 0.55
95 0.48
96 0.47
97 0.47
98 0.5
99 0.54
100 0.62
101 0.63
102 0.69
103 0.76
104 0.73
105 0.71
106 0.63
107 0.54
108 0.45
109 0.37
110 0.29
111 0.22
112 0.2
113 0.18
114 0.19
115 0.19
116 0.18
117 0.18
118 0.18
119 0.17
120 0.17
121 0.15
122 0.14
123 0.14
124 0.15
125 0.16
126 0.17
127 0.16
128 0.15
129 0.12
130 0.12
131 0.1
132 0.09
133 0.1
134 0.08
135 0.08
136 0.11
137 0.14
138 0.19
139 0.22
140 0.23
141 0.22
142 0.25
143 0.27
144 0.24
145 0.31
146 0.33
147 0.39
148 0.45
149 0.48
150 0.5
151 0.56
152 0.66
153 0.65
154 0.69
155 0.7
156 0.69
157 0.76
158 0.75
159 0.71
160 0.63
161 0.58
162 0.53
163 0.51
164 0.49
165 0.43
166 0.43
167 0.4
168 0.42
169 0.39
170 0.36
171 0.31
172 0.33
173 0.35
174 0.38
175 0.44
176 0.41
177 0.46
178 0.45
179 0.47
180 0.49
181 0.44
182 0.37
183 0.35
184 0.39
185 0.35
186 0.34
187 0.29
188 0.23
189 0.23
190 0.23
191 0.21
192 0.21
193 0.18
194 0.17
195 0.18
196 0.16
197 0.14
198 0.13
199 0.12
200 0.08
201 0.09
202 0.09
203 0.1
204 0.16
205 0.17
206 0.23
207 0.23
208 0.23
209 0.24
210 0.26
211 0.26
212 0.23
213 0.25
214 0.25
215 0.24
216 0.24
217 0.23
218 0.22
219 0.21
220 0.18
221 0.15
222 0.09
223 0.08
224 0.1
225 0.09
226 0.08
227 0.08
228 0.08
229 0.08
230 0.08
231 0.07
232 0.06
233 0.06
234 0.05
235 0.05
236 0.05
237 0.05
238 0.05
239 0.05
240 0.06
241 0.06
242 0.07
243 0.07
244 0.07
245 0.09
246 0.15
247 0.15
248 0.19
249 0.21
250 0.21
251 0.27
252 0.35
253 0.41
254 0.45
255 0.55
256 0.6
257 0.69
258 0.79
259 0.81
260 0.84
261 0.88
262 0.89
263 0.9
264 0.9
265 0.89
266 0.9
267 0.91
268 0.9
269 0.88
270 0.85
271 0.83
272 0.84
273 0.86
274 0.86
275 0.87
276 0.88
277 0.86
278 0.87
279 0.86
280 0.8
281 0.78
282 0.75
283 0.74
284 0.73
285 0.69
286 0.66
287 0.64
288 0.65
289 0.59
290 0.6
291 0.59
292 0.52
293 0.53
294 0.52
295 0.49
296 0.44
297 0.43
298 0.33
299 0.31
300 0.34
301 0.38
302 0.42
303 0.45
304 0.45
305 0.48
306 0.52
307 0.47
308 0.43
309 0.38
310 0.33
311 0.36
312 0.36
313 0.39
314 0.4
315 0.45
316 0.47
317 0.44
318 0.4
319 0.35
320 0.34
321 0.27
322 0.22
323 0.16
324 0.13
325 0.12
326 0.11
327 0.08
328 0.08
329 0.07
330 0.08
331 0.1
332 0.13
333 0.14
334 0.19
335 0.21
336 0.26
337 0.32
338 0.4
339 0.46
340 0.49
341 0.55
342 0.56
343 0.57
344 0.53
345 0.47
346 0.4
347 0.31
348 0.24
349 0.17
350 0.12
351 0.09
352 0.09
353 0.08
354 0.08
355 0.08
356 0.09
357 0.1
358 0.11
359 0.19
360 0.22
361 0.25
362 0.27
363 0.31
364 0.31
365 0.4
366 0.43
367 0.4
368 0.42
369 0.44
370 0.49
371 0.47
372 0.48
373 0.4
374 0.38
375 0.36
376 0.36
377 0.41
378 0.35
379 0.35
380 0.35
381 0.41
382 0.43
383 0.45
384 0.45
385 0.38
386 0.39
387 0.4
388 0.45
389 0.47
390 0.54
391 0.6
392 0.62
393 0.68
394 0.7
395 0.75
396 0.76
397 0.76
398 0.74
399 0.73
400 0.74
401 0.73
402 0.71
403 0.68
404 0.64
405 0.61