Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

W6Y1W4

Protein Details
Accession W6Y1W4   
Localization Confidence Medium
Confidence Score 12.8
NoLS Segment(s)
PositionSequenceProtein Nature
274-309MYLISVKRQRKLKMKKHKYKKLMKRTRLLRRKLDRTBasic
NLS Segment(s)
PositionSequence
279-308VKRQRKLKMKKHKYKKLMKRTRLLRRKLDR
Subcellular Location(s) mito 14, nucl 13
Family & Domain DBs
InterPro View protein in InterPro  
IPR013177  COX24_C  
KEGG bze:COCCADRAFT_27686  -  
Pfam View protein in Pfam  
PF08213  COX24_C  
Amino Acid Sequences MFSPAVGRVARSANTFSAAPYAALNACARSALSTSTAPQQPFRPSHQRRYSSSKPSTPANNKKKPAELDQNATAELQGAGQKTKGQKKLKQPSTATLGNNVPFVPPTNHLREDDVKLSAFFGLHRPISISRAFPNSTSTAEFDAFFDVDRASQVERIEATKNVLSGFLERMHAEIDAQEEQRADATQSDQQVYHLDVQPTQHSVESWAARLVPFQPPAPPEPYDPLATEPETDSYSAEGLSASINQRITEVTLPSEESKPRSFRQHVAKRRFGMYLISVKRQRKLKMKKHKYKKLMKRTRLLRRKLDRT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.25
3 0.22
4 0.21
5 0.2
6 0.17
7 0.14
8 0.15
9 0.13
10 0.15
11 0.15
12 0.12
13 0.12
14 0.12
15 0.12
16 0.11
17 0.11
18 0.11
19 0.13
20 0.14
21 0.16
22 0.23
23 0.28
24 0.28
25 0.3
26 0.33
27 0.38
28 0.41
29 0.47
30 0.51
31 0.54
32 0.63
33 0.7
34 0.72
35 0.7
36 0.75
37 0.76
38 0.76
39 0.76
40 0.72
41 0.65
42 0.64
43 0.68
44 0.7
45 0.72
46 0.72
47 0.73
48 0.74
49 0.75
50 0.76
51 0.71
52 0.68
53 0.68
54 0.63
55 0.59
56 0.57
57 0.54
58 0.47
59 0.42
60 0.33
61 0.23
62 0.17
63 0.12
64 0.1
65 0.09
66 0.1
67 0.1
68 0.14
69 0.21
70 0.29
71 0.37
72 0.44
73 0.5
74 0.6
75 0.71
76 0.76
77 0.77
78 0.72
79 0.68
80 0.66
81 0.64
82 0.53
83 0.47
84 0.41
85 0.33
86 0.31
87 0.26
88 0.19
89 0.14
90 0.16
91 0.14
92 0.14
93 0.18
94 0.23
95 0.25
96 0.26
97 0.3
98 0.31
99 0.32
100 0.31
101 0.27
102 0.22
103 0.2
104 0.2
105 0.16
106 0.12
107 0.09
108 0.1
109 0.11
110 0.11
111 0.11
112 0.13
113 0.13
114 0.16
115 0.17
116 0.16
117 0.15
118 0.19
119 0.19
120 0.18
121 0.2
122 0.19
123 0.19
124 0.18
125 0.17
126 0.15
127 0.15
128 0.15
129 0.12
130 0.12
131 0.1
132 0.09
133 0.08
134 0.06
135 0.06
136 0.06
137 0.06
138 0.06
139 0.08
140 0.08
141 0.08
142 0.09
143 0.1
144 0.11
145 0.11
146 0.13
147 0.11
148 0.11
149 0.11
150 0.11
151 0.09
152 0.09
153 0.1
154 0.09
155 0.09
156 0.09
157 0.09
158 0.09
159 0.09
160 0.08
161 0.07
162 0.08
163 0.09
164 0.1
165 0.1
166 0.09
167 0.1
168 0.1
169 0.1
170 0.08
171 0.07
172 0.08
173 0.1
174 0.12
175 0.13
176 0.13
177 0.13
178 0.14
179 0.14
180 0.16
181 0.17
182 0.16
183 0.16
184 0.18
185 0.18
186 0.19
187 0.18
188 0.14
189 0.11
190 0.13
191 0.17
192 0.16
193 0.16
194 0.15
195 0.14
196 0.14
197 0.15
198 0.15
199 0.15
200 0.16
201 0.16
202 0.18
203 0.2
204 0.23
205 0.26
206 0.25
207 0.23
208 0.26
209 0.28
210 0.26
211 0.25
212 0.24
213 0.23
214 0.22
215 0.21
216 0.17
217 0.16
218 0.15
219 0.15
220 0.13
221 0.11
222 0.1
223 0.09
224 0.08
225 0.06
226 0.06
227 0.06
228 0.08
229 0.09
230 0.12
231 0.12
232 0.12
233 0.13
234 0.13
235 0.15
236 0.15
237 0.15
238 0.14
239 0.14
240 0.17
241 0.19
242 0.22
243 0.23
244 0.25
245 0.3
246 0.34
247 0.37
248 0.44
249 0.47
250 0.51
251 0.59
252 0.65
253 0.69
254 0.74
255 0.78
256 0.73
257 0.71
258 0.65
259 0.54
260 0.48
261 0.43
262 0.43
263 0.39
264 0.44
265 0.48
266 0.51
267 0.57
268 0.6
269 0.63
270 0.64
271 0.71
272 0.73
273 0.77
274 0.84
275 0.88
276 0.92
277 0.95
278 0.95
279 0.95
280 0.95
281 0.95
282 0.94
283 0.93
284 0.92
285 0.92
286 0.92
287 0.92
288 0.9
289 0.89