Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

W6YNJ1

Protein Details
Accession W6YNJ1   
Localization Confidence Medium
Confidence Score 10.3
NoLS Segment(s)
PositionSequenceProtein Nature
144-166DSANPNGKKIKWRKRPWTSAGQWHydrophilic
NLS Segment(s)
PositionSequence
151-157KKIKWRK
Subcellular Location(s) nucl 7, cyto 6, mito_nucl 6, mito 5, extr 3, pero 3
Family & Domain DBs
KEGG bze:COCCADRAFT_97166  -  
Amino Acid Sequences MTNAERALKLLMLILAAIYQTSTDMSKAYGIPMKSFLTDKSRYPAFDLEGPEITAERFACQLDVTDALIRRTQVTVVICNAEMCGVDGLCFDSFDEDAPGTSDRRGMGFGSVKARDTLLDTSPAEHHGALEKRDNMDVEFECVDSANPNGKKIKWRKRPWTSAGQWPSNNPIYDNALTHMYEEHCSMTNLRVSQLPDGEYYASKSTITLSCML
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.08
2 0.06
3 0.06
4 0.05
5 0.04
6 0.04
7 0.04
8 0.06
9 0.06
10 0.07
11 0.07
12 0.08
13 0.1
14 0.11
15 0.14
16 0.17
17 0.17
18 0.19
19 0.22
20 0.22
21 0.22
22 0.22
23 0.22
24 0.25
25 0.27
26 0.28
27 0.3
28 0.32
29 0.31
30 0.34
31 0.33
32 0.29
33 0.31
34 0.31
35 0.28
36 0.26
37 0.25
38 0.22
39 0.19
40 0.16
41 0.13
42 0.11
43 0.08
44 0.08
45 0.08
46 0.09
47 0.08
48 0.09
49 0.08
50 0.09
51 0.09
52 0.12
53 0.13
54 0.13
55 0.15
56 0.14
57 0.14
58 0.13
59 0.13
60 0.13
61 0.13
62 0.14
63 0.14
64 0.15
65 0.14
66 0.13
67 0.13
68 0.09
69 0.08
70 0.07
71 0.06
72 0.04
73 0.05
74 0.05
75 0.06
76 0.06
77 0.06
78 0.05
79 0.06
80 0.06
81 0.06
82 0.07
83 0.05
84 0.05
85 0.06
86 0.08
87 0.07
88 0.07
89 0.08
90 0.08
91 0.08
92 0.09
93 0.08
94 0.1
95 0.11
96 0.13
97 0.16
98 0.16
99 0.16
100 0.16
101 0.16
102 0.13
103 0.14
104 0.14
105 0.11
106 0.13
107 0.13
108 0.14
109 0.15
110 0.16
111 0.14
112 0.12
113 0.11
114 0.13
115 0.15
116 0.16
117 0.2
118 0.2
119 0.21
120 0.22
121 0.22
122 0.17
123 0.19
124 0.17
125 0.15
126 0.14
127 0.13
128 0.12
129 0.11
130 0.11
131 0.08
132 0.09
133 0.15
134 0.15
135 0.18
136 0.21
137 0.23
138 0.33
139 0.43
140 0.53
141 0.56
142 0.66
143 0.74
144 0.81
145 0.88
146 0.85
147 0.85
148 0.79
149 0.79
150 0.76
151 0.71
152 0.62
153 0.55
154 0.55
155 0.49
156 0.44
157 0.35
158 0.3
159 0.29
160 0.29
161 0.27
162 0.23
163 0.21
164 0.21
165 0.2
166 0.2
167 0.16
168 0.16
169 0.16
170 0.16
171 0.14
172 0.16
173 0.16
174 0.17
175 0.2
176 0.2
177 0.2
178 0.22
179 0.23
180 0.26
181 0.27
182 0.25
183 0.22
184 0.23
185 0.23
186 0.21
187 0.22
188 0.2
189 0.19
190 0.17
191 0.16
192 0.18
193 0.19