Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

W6Y9A8

Protein Details
Accession W6Y9A8   
Localization Confidence Medium
Confidence Score 11.3
NoLS Segment(s)
PositionSequenceProtein Nature
83-102GGTKKQKREKVNPRISQRKABasic
NLS Segment(s)
PositionSequence
86-92KKQKREK
Subcellular Location(s) nucl 10mito 10mito_nucl 10
Family & Domain DBs
KEGG bze:COCCADRAFT_36161  -  
Amino Acid Sequences MVDYSHRAVELTRVFPFGPRVCHCFLATGNGFTLLAINSLAMLDDQHKQGAAVRRDSAKRKYTKGNMEYMPKEKRYGDNNVAGGTKKQKREKVNPRISQRKAVITGIFSCFLHIQHAHFLLYGEDRIHSINHLAPQKAKRNPSIRTPLVPKGSTRLHPFSNTRLSQNDPLSTT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.27
3 0.33
4 0.3
5 0.32
6 0.32
7 0.36
8 0.38
9 0.4
10 0.38
11 0.34
12 0.31
13 0.32
14 0.3
15 0.26
16 0.23
17 0.21
18 0.2
19 0.17
20 0.17
21 0.09
22 0.08
23 0.06
24 0.06
25 0.05
26 0.05
27 0.05
28 0.04
29 0.04
30 0.06
31 0.09
32 0.1
33 0.1
34 0.1
35 0.1
36 0.15
37 0.23
38 0.25
39 0.25
40 0.27
41 0.33
42 0.38
43 0.45
44 0.47
45 0.47
46 0.49
47 0.51
48 0.57
49 0.6
50 0.64
51 0.61
52 0.6
53 0.55
54 0.56
55 0.55
56 0.52
57 0.5
58 0.41
59 0.4
60 0.34
61 0.35
62 0.33
63 0.37
64 0.35
65 0.35
66 0.34
67 0.33
68 0.32
69 0.27
70 0.25
71 0.25
72 0.26
73 0.29
74 0.34
75 0.4
76 0.47
77 0.57
78 0.67
79 0.7
80 0.75
81 0.76
82 0.79
83 0.82
84 0.77
85 0.73
86 0.65
87 0.57
88 0.49
89 0.43
90 0.35
91 0.27
92 0.27
93 0.21
94 0.2
95 0.16
96 0.15
97 0.13
98 0.13
99 0.14
100 0.13
101 0.12
102 0.14
103 0.15
104 0.14
105 0.14
106 0.14
107 0.12
108 0.12
109 0.12
110 0.09
111 0.08
112 0.09
113 0.1
114 0.09
115 0.09
116 0.1
117 0.12
118 0.17
119 0.21
120 0.22
121 0.27
122 0.35
123 0.43
124 0.48
125 0.51
126 0.54
127 0.58
128 0.6
129 0.64
130 0.66
131 0.61
132 0.62
133 0.63
134 0.62
135 0.61
136 0.58
137 0.5
138 0.47
139 0.49
140 0.48
141 0.49
142 0.46
143 0.43
144 0.48
145 0.51
146 0.51
147 0.55
148 0.52
149 0.49
150 0.47
151 0.5
152 0.51
153 0.52