Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

W6YC06

Protein Details
Accession W6YC06   
Localization Confidence Medium
Confidence Score 14.3
NoLS Segment(s)
PositionSequenceProtein Nature
1-32MPKEKTTRKAAPKTKAEKKKKAPDPNAPKRGLBasic
NLS Segment(s)
PositionSequence
5-30KTTRKAAPKTKAEKKKKAPDPNAPKR
Subcellular Location(s) nucl 17, cyto 6, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR009071  HMG_box_dom  
IPR036910  HMG_box_dom_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
KEGG bze:COCCADRAFT_86510  -  
Pfam View protein in Pfam  
PF00505  HMG_box  
PROSITE View protein in PROSITE  
PS50118  HMG_BOX_2  
CDD cd01390  HMG-box_NHP6-like  
Amino Acid Sequences MPKEKTTRKAAPKTKAEKKKKAPDPNAPKRGLSAYMFFANEQREKVREDNPGIKFGEVGKLLGEKWKALNDKQRQPYEAKAALDKKRYEQEKAAYTVCFPHPLCPKITC
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.86
2 0.88
3 0.88
4 0.88
5 0.89
6 0.9
7 0.9
8 0.91
9 0.89
10 0.89
11 0.9
12 0.9
13 0.88
14 0.8
15 0.7
16 0.61
17 0.54
18 0.46
19 0.37
20 0.28
21 0.22
22 0.22
23 0.22
24 0.2
25 0.2
26 0.2
27 0.19
28 0.18
29 0.17
30 0.16
31 0.19
32 0.22
33 0.24
34 0.26
35 0.28
36 0.35
37 0.34
38 0.36
39 0.34
40 0.3
41 0.27
42 0.22
43 0.21
44 0.14
45 0.12
46 0.09
47 0.09
48 0.1
49 0.13
50 0.13
51 0.1
52 0.11
53 0.16
54 0.18
55 0.22
56 0.32
57 0.37
58 0.46
59 0.53
60 0.55
61 0.53
62 0.53
63 0.54
64 0.52
65 0.48
66 0.4
67 0.38
68 0.43
69 0.46
70 0.5
71 0.47
72 0.45
73 0.49
74 0.52
75 0.5
76 0.48
77 0.5
78 0.49
79 0.52
80 0.48
81 0.4
82 0.37
83 0.37
84 0.32
85 0.32
86 0.26
87 0.3
88 0.36
89 0.38