Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

W6YHL3

Protein Details
Accession W6YHL3   
Localization Confidence Medium
Confidence Score 12.9
NoLS Segment(s)
PositionSequenceProtein Nature
34-53EAEKKPQKAKKAPVKKDDSSBasic
NLS Segment(s)
PositionSequence
37-47KKPQKAKKAPV
Subcellular Location(s) nucl 18.5, cyto_nucl 13, cyto 6.5
Family & Domain DBs
KEGG bze:COCCADRAFT_91513  -  
Amino Acid Sequences MDVDEESASSSDSSSGSDSDSDSDSSSDSSSESEAEKKPQKAKKAPVKKDDSSSSSSDSSSDSSDSE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.09
2 0.09
3 0.09
4 0.1
5 0.1
6 0.1
7 0.12
8 0.11
9 0.1
10 0.1
11 0.1
12 0.1
13 0.1
14 0.08
15 0.07
16 0.07
17 0.07
18 0.07
19 0.07
20 0.1
21 0.11
22 0.17
23 0.22
24 0.26
25 0.34
26 0.38
27 0.46
28 0.51
29 0.61
30 0.66
31 0.71
32 0.76
33 0.78
34 0.81
35 0.75
36 0.74
37 0.7
38 0.63
39 0.57
40 0.5
41 0.45
42 0.38
43 0.34
44 0.28
45 0.24
46 0.21
47 0.19