Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

W6XVJ7

Protein Details
Accession W6XVJ7    Localization Confidence Medium Confidence Score 12.4
NoLS Segment(s)
PositionSequenceProtein Nature
53-73ASLPSKPKGKAPKAEKKPRGIBasic
NLS Segment(s)
PositionSequence
38-71ARKKAEKEALLREEEASLPSKPKGKAPKAEKKPR
Subcellular Location(s) nucl 17, cyto_nucl 13.5, cyto 8
Family & Domain DBs
InterPro View protein in InterPro  
IPR010422  Ccdc124/Oxs1  
KEGG bze:COCCADRAFT_101246  -  
Pfam View protein in Pfam  
PF06244  Ccdc124  
Amino Acid Sequences MEEGCKVQCEGVGGLVSLCNCRLTHDSEAAAEKAAEAARKKAEKEALLREEEASLPSKPKGKAPKAEKKPRGIDAALGSLDGKPSTLNASGIDDALDALDITSNTQEKVDRHPERRFKTALAAYENKRLEDMKDDKTLRRQQKINQIKKEFETHPSNPYRQVTGAYNMTREERAAIQEEEKAKKEKRLVGVN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.13
3 0.12
4 0.11
5 0.11
6 0.11
7 0.1
8 0.15
9 0.18
10 0.22
11 0.26
12 0.28
13 0.28
14 0.28
15 0.31
16 0.27
17 0.25
18 0.19
19 0.14
20 0.13
21 0.13
22 0.15
23 0.14
24 0.17
25 0.23
26 0.26
27 0.28
28 0.32
29 0.36
30 0.37
31 0.41
32 0.46
33 0.44
34 0.43
35 0.43
36 0.37
37 0.33
38 0.29
39 0.24
40 0.18
41 0.14
42 0.14
43 0.15
44 0.21
45 0.21
46 0.27
47 0.36
48 0.4
49 0.49
50 0.57
51 0.65
52 0.7
53 0.8
54 0.8
55 0.78
56 0.77
57 0.71
58 0.66
59 0.55
60 0.47
61 0.38
62 0.33
63 0.25
64 0.2
65 0.16
66 0.11
67 0.11
68 0.08
69 0.07
70 0.04
71 0.05
72 0.07
73 0.07
74 0.07
75 0.07
76 0.1
77 0.1
78 0.1
79 0.09
80 0.07
81 0.06
82 0.06
83 0.05
84 0.03
85 0.02
86 0.03
87 0.03
88 0.03
89 0.04
90 0.05
91 0.05
92 0.06
93 0.08
94 0.09
95 0.16
96 0.26
97 0.31
98 0.37
99 0.46
100 0.54
101 0.57
102 0.61
103 0.56
104 0.46
105 0.47
106 0.44
107 0.39
108 0.36
109 0.37
110 0.35
111 0.41
112 0.41
113 0.34
114 0.31
115 0.28
116 0.24
117 0.26
118 0.29
119 0.25
120 0.32
121 0.35
122 0.37
123 0.46
124 0.54
125 0.54
126 0.57
127 0.58
128 0.57
129 0.66
130 0.74
131 0.74
132 0.75
133 0.72
134 0.68
135 0.66
136 0.66
137 0.57
138 0.54
139 0.52
140 0.44
141 0.48
142 0.5
143 0.49
144 0.48
145 0.48
146 0.44
147 0.37
148 0.37
149 0.32
150 0.32
151 0.36
152 0.31
153 0.3
154 0.29
155 0.31
156 0.28
157 0.25
158 0.22
159 0.17
160 0.19
161 0.22
162 0.22
163 0.22
164 0.26
165 0.32
166 0.35
167 0.37
168 0.41
169 0.4
170 0.46
171 0.52
172 0.54