Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

W6YKD8

Protein Details
Accession W6YKD8   
Localization Confidence Low
Confidence Score 9.2
NoLS Segment(s)
PositionSequenceProtein Nature
80-104SIYPPFAQKKIKKKIKAKSSVAFPTHydrophilic
NLS Segment(s)
PositionSequence
88-98KKIKKKIKAKS
Subcellular Location(s) mito 19.5, mito_nucl 12.999, cyto_nucl 5.333, nucl 5
Family & Domain DBs
KEGG bze:COCCADRAFT_83827  -  
Amino Acid Sequences TGPNRSSWPPSTRPSPPPPPPPACPYKTLISDLSRPGTQPIKRIPQLLFAKNAFTSPSPSEEFPWKNHFGSGGRRPHNTSIYPPFAQKKIKKKIKAKSSVAFPTYKVKR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.62
2 0.66
3 0.68
4 0.71
5 0.74
6 0.73
7 0.7
8 0.69
9 0.68
10 0.61
11 0.56
12 0.51
13 0.47
14 0.43
15 0.41
16 0.38
17 0.33
18 0.34
19 0.33
20 0.32
21 0.27
22 0.25
23 0.25
24 0.29
25 0.27
26 0.29
27 0.32
28 0.37
29 0.38
30 0.41
31 0.39
32 0.41
33 0.45
34 0.42
35 0.39
36 0.31
37 0.31
38 0.28
39 0.27
40 0.19
41 0.14
42 0.15
43 0.12
44 0.15
45 0.15
46 0.16
47 0.17
48 0.23
49 0.24
50 0.24
51 0.29
52 0.29
53 0.28
54 0.27
55 0.28
56 0.24
57 0.3
58 0.36
59 0.39
60 0.39
61 0.42
62 0.45
63 0.48
64 0.49
65 0.43
66 0.41
67 0.4
68 0.42
69 0.41
70 0.42
71 0.42
72 0.43
73 0.5
74 0.51
75 0.54
76 0.59
77 0.68
78 0.74
79 0.79
80 0.84
81 0.85
82 0.88
83 0.85
84 0.82
85 0.81
86 0.79
87 0.73
88 0.65
89 0.56