Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

W6Y7I7

Protein Details
Accession W6Y7I7    Localization Confidence Medium Confidence Score 11.5
NoLS Segment(s)
PositionSequenceProtein Nature
57-86GNLHSASSPQPRRRRRRPGAARVRLGKKPHBasic
NLS Segment(s)
PositionSequence
67-86PRRRRRRPGAARVRLGKKPH
Subcellular Location(s) nucl 9, mito 7, extr 5, cyto_mito 5
Family & Domain DBs
KEGG bze:COCCADRAFT_101770  -  
Amino Acid Sequences MSVLSIVILRPSPAHFPILCCSFACLLVFPFFSTSSPLCCILIPPPPDPARCPSSPGNLHSASSPQPRRRRRRPGAARVRLGKKPHNQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.2
3 0.23
4 0.27
5 0.29
6 0.28
7 0.23
8 0.24
9 0.2
10 0.2
11 0.18
12 0.13
13 0.12
14 0.12
15 0.12
16 0.1
17 0.11
18 0.1
19 0.1
20 0.13
21 0.12
22 0.12
23 0.14
24 0.14
25 0.13
26 0.13
27 0.13
28 0.12
29 0.17
30 0.18
31 0.17
32 0.21
33 0.22
34 0.23
35 0.25
36 0.27
37 0.27
38 0.24
39 0.28
40 0.26
41 0.32
42 0.34
43 0.35
44 0.36
45 0.31
46 0.31
47 0.27
48 0.27
49 0.25
50 0.31
51 0.37
52 0.4
53 0.5
54 0.6
55 0.7
56 0.78
57 0.85
58 0.85
59 0.89
60 0.91
61 0.92
62 0.93
63 0.92
64 0.9
65 0.89
66 0.86
67 0.81
68 0.77