Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

W6XNP5

Protein Details
Accession W6XNP5   
Localization Confidence Medium
Confidence Score 14.9
NoLS Segment(s)
PositionSequenceProtein Nature
58-77HKDAREKTKKPNRPNPASHHBasic
82-107SQGYRLTHSRKKDNKKQATREKTLTGHydrophilic
NLS Segment(s)
PositionSequence
62-70REKTKKPNR
Subcellular Location(s) nucl 17.5, cyto_nucl 11.5, mito 7
Family & Domain DBs
KEGG bze:COCCADRAFT_29881  -  
Amino Acid Sequences MSFTEKGNIMAIIREMRNPLCPPQIDINPVLGNMREIRPANQALFDFPIPSRRDTHMHKDAREKTKKPNRPNPASHHPIAESQGYRLTHSRKKDNKKQATREKTLTGPRTQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.2
3 0.2
4 0.25
5 0.27
6 0.29
7 0.3
8 0.3
9 0.32
10 0.36
11 0.38
12 0.36
13 0.34
14 0.33
15 0.27
16 0.26
17 0.23
18 0.16
19 0.14
20 0.13
21 0.13
22 0.15
23 0.15
24 0.17
25 0.21
26 0.22
27 0.21
28 0.21
29 0.2
30 0.17
31 0.18
32 0.16
33 0.13
34 0.11
35 0.18
36 0.17
37 0.19
38 0.2
39 0.21
40 0.26
41 0.29
42 0.37
43 0.4
44 0.42
45 0.43
46 0.5
47 0.55
48 0.61
49 0.64
50 0.58
51 0.6
52 0.67
53 0.73
54 0.74
55 0.76
56 0.76
57 0.77
58 0.81
59 0.79
60 0.78
61 0.75
62 0.66
63 0.58
64 0.49
65 0.42
66 0.37
67 0.33
68 0.25
69 0.19
70 0.24
71 0.22
72 0.23
73 0.27
74 0.31
75 0.33
76 0.4
77 0.5
78 0.54
79 0.65
80 0.73
81 0.79
82 0.83
83 0.88
84 0.91
85 0.92
86 0.92
87 0.89
88 0.84
89 0.78
90 0.74
91 0.74