Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

W6YQN1

Protein Details
Accession W6YQN1    Localization Confidence Medium Confidence Score 11.7
NoLS Segment(s)
PositionSequenceProtein Nature
1-28MGKRHNRKRTRSRPRNRNNNNNNPNANNHydrophilic
NLS Segment(s)
PositionSequence
3-16KRHNRKRTRSRPRN
Subcellular Location(s) mito 13, nucl 11.5, cyto_nucl 7
Family & Domain DBs
KEGG bze:COCCADRAFT_1431  -  
Amino Acid Sequences MGKRHNRKRTRSRPRNRNNNNNNPNANNLNINTTPIHIRSESVSTASSTLSPTSSCFQPSGCPLANVPANHWQQTYTAWQMRLRIQREQEQELELETQRLRIFGGLPEDERCLMEPMLKVVTDLFDGFYDYEDP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.96
2 0.96
3 0.95
4 0.95
5 0.94
6 0.95
7 0.92
8 0.89
9 0.83
10 0.74
11 0.68
12 0.59
13 0.5
14 0.42
15 0.34
16 0.31
17 0.26
18 0.26
19 0.21
20 0.2
21 0.2
22 0.18
23 0.2
24 0.15
25 0.15
26 0.15
27 0.18
28 0.17
29 0.16
30 0.15
31 0.13
32 0.13
33 0.13
34 0.11
35 0.09
36 0.09
37 0.08
38 0.08
39 0.09
40 0.11
41 0.12
42 0.12
43 0.12
44 0.12
45 0.13
46 0.15
47 0.18
48 0.16
49 0.15
50 0.14
51 0.17
52 0.2
53 0.18
54 0.18
55 0.22
56 0.23
57 0.23
58 0.23
59 0.2
60 0.18
61 0.19
62 0.21
63 0.17
64 0.19
65 0.2
66 0.21
67 0.24
68 0.3
69 0.35
70 0.35
71 0.35
72 0.36
73 0.42
74 0.46
75 0.46
76 0.41
77 0.35
78 0.32
79 0.27
80 0.26
81 0.19
82 0.16
83 0.13
84 0.14
85 0.13
86 0.13
87 0.12
88 0.11
89 0.11
90 0.12
91 0.17
92 0.16
93 0.17
94 0.19
95 0.2
96 0.2
97 0.2
98 0.19
99 0.17
100 0.15
101 0.17
102 0.16
103 0.17
104 0.19
105 0.18
106 0.16
107 0.14
108 0.15
109 0.13
110 0.13
111 0.11
112 0.1
113 0.11
114 0.11