Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

W6YMM9

Protein Details
Accession W6YMM9   
Localization Confidence Medium
Confidence Score 14.4
NoLS Segment(s)
PositionSequenceProtein Nature
140-164AAAATTKKGRGRPKKQPKIESTDEEHydrophilic
NLS Segment(s)
PositionSequence
96-108PAAPKSRKRKPAD
123-157EPDKKPTKKKAATTTAAAAAATTKKGRGRPKKQPK
Subcellular Location(s) nucl 17, cyto_nucl 12.5, cyto 6, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR000637  HMGI/Y_DNA-bd_CS  
Gene Ontology GO:0005634  C:nucleus  
GO:0006355  P:regulation of DNA-templated transcription  
KEGG bze:COCCADRAFT_81142  -  
PROSITE View protein in PROSITE  
PS00354  HMGI_Y  
Amino Acid Sequences MPPKKDTTGEDANVLLPGFTDKETKLIAAAFLSSIGPDKFDYETMAALTKNTAGSLKKMWPPVKRKPMESHPPFAKFLGQSNGDATASTSEAPKLPAAPKSRKRKPADEASEDPAKPEPDSSEPDKKPTKKKAATTTAAAAAATTKKGRGRPKKQPKIESTDEENSADGGDGRGEFTSKRAVQRWLQSTDYE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.18
3 0.1
4 0.1
5 0.1
6 0.1
7 0.13
8 0.12
9 0.15
10 0.16
11 0.16
12 0.15
13 0.14
14 0.13
15 0.11
16 0.11
17 0.08
18 0.08
19 0.08
20 0.07
21 0.09
22 0.08
23 0.09
24 0.09
25 0.11
26 0.12
27 0.12
28 0.14
29 0.12
30 0.13
31 0.12
32 0.13
33 0.11
34 0.1
35 0.1
36 0.09
37 0.09
38 0.08
39 0.11
40 0.1
41 0.13
42 0.16
43 0.21
44 0.24
45 0.32
46 0.37
47 0.43
48 0.5
49 0.58
50 0.65
51 0.64
52 0.64
53 0.64
54 0.68
55 0.7
56 0.67
57 0.65
58 0.59
59 0.59
60 0.55
61 0.48
62 0.41
63 0.31
64 0.29
65 0.26
66 0.22
67 0.19
68 0.18
69 0.19
70 0.16
71 0.15
72 0.12
73 0.08
74 0.07
75 0.07
76 0.07
77 0.06
78 0.07
79 0.08
80 0.07
81 0.08
82 0.1
83 0.15
84 0.21
85 0.3
86 0.38
87 0.48
88 0.56
89 0.64
90 0.67
91 0.69
92 0.7
93 0.71
94 0.7
95 0.67
96 0.62
97 0.57
98 0.57
99 0.49
100 0.43
101 0.35
102 0.28
103 0.21
104 0.18
105 0.16
106 0.14
107 0.19
108 0.24
109 0.32
110 0.32
111 0.38
112 0.46
113 0.5
114 0.57
115 0.62
116 0.67
117 0.64
118 0.71
119 0.75
120 0.75
121 0.72
122 0.66
123 0.58
124 0.49
125 0.43
126 0.34
127 0.24
128 0.17
129 0.15
130 0.13
131 0.12
132 0.13
133 0.17
134 0.24
135 0.34
136 0.44
137 0.53
138 0.62
139 0.73
140 0.81
141 0.87
142 0.9
143 0.87
144 0.85
145 0.82
146 0.76
147 0.73
148 0.67
149 0.6
150 0.51
151 0.43
152 0.34
153 0.28
154 0.21
155 0.14
156 0.09
157 0.08
158 0.07
159 0.08
160 0.08
161 0.09
162 0.09
163 0.11
164 0.19
165 0.22
166 0.29
167 0.32
168 0.38
169 0.44
170 0.54
171 0.59
172 0.55