Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

W6YBG7

Protein Details
Accession W6YBG7    Localization Confidence High Confidence Score 15
NoLS Segment(s)
PositionSequenceProtein Nature
21-40KSACIKKNKKVNNIKFKVRCHydrophilic
NLS Segment(s)
PositionSequence
74-80KNPKGKR
Subcellular Location(s) nucl 21, mito 3, cyto 3, cyto_mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR002675  Ribosomal_L38e  
IPR038464  Ribosomal_L38e_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
KEGG bze:COCCADRAFT_2120  -  
Pfam View protein in Pfam  
PF01781  Ribosomal_L38e  
Amino Acid Sequences MPSEVSDIKQFIEICRRKDAKSACIKKNKKVNNIKFKVRCSTNLYTLVLKDTDKAEKLKQSLPPGLTISDVGKKNPKGKRTA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.34
2 0.43
3 0.45
4 0.42
5 0.5
6 0.51
7 0.5
8 0.56
9 0.62
10 0.61
11 0.69
12 0.72
13 0.72
14 0.77
15 0.75
16 0.75
17 0.77
18 0.78
19 0.78
20 0.8
21 0.81
22 0.77
23 0.73
24 0.69
25 0.6
26 0.54
27 0.5
28 0.47
29 0.42
30 0.39
31 0.37
32 0.31
33 0.29
34 0.27
35 0.2
36 0.16
37 0.13
38 0.12
39 0.14
40 0.15
41 0.18
42 0.2
43 0.24
44 0.27
45 0.31
46 0.34
47 0.37
48 0.41
49 0.39
50 0.39
51 0.35
52 0.32
53 0.28
54 0.24
55 0.21
56 0.23
57 0.23
58 0.24
59 0.31
60 0.36
61 0.44
62 0.5