Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

W6YBC2

Protein Details
Accession W6YBC2   
Localization Confidence Medium
Confidence Score 12.8
NoLS Segment(s)
PositionSequenceProtein Nature
49-69SLNPSPPKKAPARRPKGKQKDBasic
NLS Segment(s)
PositionSequence
54-69PPKKAPARRPKGKQKD
Subcellular Location(s) nucl 17, cyto_nucl 10.5, mito 8
Family & Domain DBs
KEGG bze:COCCADRAFT_109082  -  
Amino Acid Sequences MLLDFQNTWVKIKVRRYEENSQTRAQRKKLNSRPYIHIRTDGKKNCILSLNPSPPKKAPARRPKGKQKD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.49
2 0.57
3 0.62
4 0.67
5 0.73
6 0.75
7 0.7
8 0.66
9 0.65
10 0.65
11 0.63
12 0.58
13 0.56
14 0.55
15 0.62
16 0.67
17 0.7
18 0.7
19 0.68
20 0.7
21 0.71
22 0.69
23 0.59
24 0.56
25 0.51
26 0.48
27 0.53
28 0.51
29 0.46
30 0.44
31 0.44
32 0.39
33 0.39
34 0.35
35 0.32
36 0.36
37 0.42
38 0.46
39 0.47
40 0.49
41 0.46
42 0.53
43 0.55
44 0.56
45 0.57
46 0.61
47 0.71
48 0.77
49 0.86