Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

W6Y4U7

Protein Details
Accession W6Y4U7   
Localization Confidence Medium
Confidence Score 14.3
NoLS Segment(s)
PositionSequenceProtein Nature
28-51AESSAIPKKRKERKKPVSGFPPTVHydrophilic
NLS Segment(s)
PositionSequence
34-43PKKRKERKKP
Subcellular Location(s) nucl 23, cyto_nucl 13.5
Family & Domain DBs
KEGG bze:COCCADRAFT_104718  -  
Amino Acid Sequences PPPPPNSYRLTLSTIYQETDERKEENNAESSAIPKKRKERKKPVSGFPPTVILGCPPLPLSLSLSASRYT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.31
2 0.28
3 0.25
4 0.24
5 0.22
6 0.24
7 0.25
8 0.21
9 0.21
10 0.24
11 0.25
12 0.25
13 0.25
14 0.21
15 0.2
16 0.19
17 0.19
18 0.22
19 0.26
20 0.26
21 0.28
22 0.37
23 0.46
24 0.56
25 0.65
26 0.7
27 0.75
28 0.83
29 0.87
30 0.86
31 0.86
32 0.82
33 0.75
34 0.65
35 0.57
36 0.46
37 0.39
38 0.3
39 0.21
40 0.17
41 0.14
42 0.14
43 0.11
44 0.11
45 0.11
46 0.12
47 0.15
48 0.16
49 0.19
50 0.2