Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

W6Y2L1

Protein Details
Accession W6Y2L1   
Localization Confidence Medium
Confidence Score 14.2
NoLS Segment(s)
PositionSequenceProtein Nature
21-51PSPGDFCRARPRRRSKKKLRVERRAPRVKVSBasic
NLS Segment(s)
PositionSequence
29-49ARPRRRSKKKLRVERRAPRVK
Subcellular Location(s) nucl 24.5, cyto_nucl 15
Family & Domain DBs
KEGG bze:COCCADRAFT_106983  -  
Amino Acid Sequences PMSAQREPLSEPPSPFTTATPSPGDFCRARPRRRSKKKLRVERRAPRVKVSHGRCRHVIAGEASSSSA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.35
2 0.32
3 0.26
4 0.28
5 0.25
6 0.27
7 0.25
8 0.23
9 0.23
10 0.23
11 0.27
12 0.21
13 0.23
14 0.31
15 0.37
16 0.42
17 0.51
18 0.61
19 0.68
20 0.78
21 0.86
22 0.86
23 0.89
24 0.93
25 0.94
26 0.93
27 0.93
28 0.93
29 0.92
30 0.91
31 0.91
32 0.82
33 0.78
34 0.72
35 0.7
36 0.68
37 0.66
38 0.66
39 0.63
40 0.66
41 0.62
42 0.62
43 0.57
44 0.49
45 0.46
46 0.38
47 0.34
48 0.29