Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

B2VS41

Protein Details
Accession B2VS41    Localization Confidence Low Confidence Score 6.5
NoLS Segment(s)
PositionSequenceProtein Nature
430-449RNENKRGLAHKKRIEAQQKKBasic
NLS Segment(s)
Subcellular Location(s) cyto 10, pero 7, mito 5, nucl 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR006091  Acyl-CoA_Oxase/DH_mid-dom  
IPR046373  Acyl-CoA_Oxase/DH_mid-dom_sf  
IPR036250  AcylCo_DH-like_C  
IPR009075  AcylCo_DH/oxidase_C  
IPR013786  AcylCoA_DH/ox_N  
IPR037069  AcylCoA_DH/ox_N_sf  
IPR009100  AcylCoA_DH/oxidase_NM_dom  
Gene Ontology GO:0050660  F:flavin adenine dinucleotide binding  
GO:0016627  F:oxidoreductase activity, acting on the CH-CH group of donors  
Pfam View protein in Pfam  
PF00441  Acyl-CoA_dh_1  
PF02770  Acyl-CoA_dh_M  
PF02771  Acyl-CoA_dh_N  
Amino Acid Sequences MSVPYDRAYDLLSNSQDGHVSASQRIPAIARPFVSERAAKTLDIVQRFVEEECIPADDVYARQLGQTVQERFTSHPSIMEDLKKRAQELGLWNMFLPKAHFKEGAGFSNLEYGLMAEYLGKSRTASEAVNCSAPDTGNMEVIAKYGSEAQKRKWLDPLLEGKIRSAFLMTEPQVASSDATNIEMTIKRDGDHYVLNGQKWWSSGIGDPRCKIFVVLGKTDPNNADKYKQQSVILVPNDTPGVTVHRMLSVMGFDDAPHGHGHVTFENVRVPASNMVLGEGRGFEIIQGRLGPGRIHHAMRSIGSAEKALEWFLARINDERKKPFGQLLNKHGIMLERVARSRIEIDAARLAVLNAAIKIDETNAKGALKEIAEVKVLVPEVNLKVIDWAMQAYGGAGVSQDTPLAQMWSSGRTMRIVDGPDEVHLLQLGRNENKRGLAHKKRIEAQQKKGEELCRKYGIEPRDPLYLNRTSGEASKL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.25
3 0.24
4 0.21
5 0.23
6 0.19
7 0.2
8 0.22
9 0.24
10 0.25
11 0.24
12 0.25
13 0.22
14 0.25
15 0.28
16 0.29
17 0.27
18 0.29
19 0.32
20 0.34
21 0.37
22 0.35
23 0.31
24 0.35
25 0.36
26 0.31
27 0.3
28 0.34
29 0.35
30 0.35
31 0.33
32 0.27
33 0.26
34 0.28
35 0.26
36 0.23
37 0.17
38 0.15
39 0.15
40 0.16
41 0.15
42 0.13
43 0.14
44 0.11
45 0.12
46 0.13
47 0.13
48 0.11
49 0.11
50 0.12
51 0.12
52 0.17
53 0.25
54 0.26
55 0.27
56 0.3
57 0.31
58 0.32
59 0.38
60 0.34
61 0.27
62 0.27
63 0.27
64 0.28
65 0.3
66 0.35
67 0.34
68 0.37
69 0.42
70 0.4
71 0.38
72 0.37
73 0.34
74 0.32
75 0.34
76 0.38
77 0.34
78 0.33
79 0.32
80 0.31
81 0.3
82 0.25
83 0.23
84 0.21
85 0.22
86 0.26
87 0.27
88 0.25
89 0.33
90 0.37
91 0.36
92 0.31
93 0.28
94 0.25
95 0.28
96 0.27
97 0.19
98 0.15
99 0.11
100 0.09
101 0.08
102 0.08
103 0.05
104 0.05
105 0.07
106 0.08
107 0.08
108 0.08
109 0.09
110 0.11
111 0.13
112 0.13
113 0.14
114 0.18
115 0.2
116 0.21
117 0.2
118 0.19
119 0.18
120 0.16
121 0.15
122 0.12
123 0.12
124 0.11
125 0.11
126 0.11
127 0.1
128 0.1
129 0.09
130 0.07
131 0.07
132 0.11
133 0.15
134 0.21
135 0.24
136 0.27
137 0.35
138 0.37
139 0.38
140 0.4
141 0.39
142 0.34
143 0.39
144 0.44
145 0.41
146 0.42
147 0.41
148 0.35
149 0.33
150 0.31
151 0.24
152 0.17
153 0.12
154 0.1
155 0.16
156 0.16
157 0.17
158 0.17
159 0.18
160 0.18
161 0.18
162 0.17
163 0.11
164 0.11
165 0.08
166 0.09
167 0.08
168 0.08
169 0.09
170 0.11
171 0.12
172 0.14
173 0.14
174 0.13
175 0.15
176 0.16
177 0.15
178 0.14
179 0.14
180 0.16
181 0.18
182 0.18
183 0.18
184 0.18
185 0.17
186 0.16
187 0.16
188 0.11
189 0.1
190 0.12
191 0.2
192 0.26
193 0.28
194 0.28
195 0.28
196 0.29
197 0.27
198 0.25
199 0.18
200 0.16
201 0.18
202 0.2
203 0.2
204 0.22
205 0.22
206 0.24
207 0.23
208 0.2
209 0.19
210 0.18
211 0.18
212 0.19
213 0.25
214 0.27
215 0.28
216 0.26
217 0.25
218 0.26
219 0.31
220 0.28
221 0.23
222 0.19
223 0.18
224 0.17
225 0.15
226 0.13
227 0.07
228 0.09
229 0.09
230 0.1
231 0.1
232 0.1
233 0.1
234 0.1
235 0.1
236 0.06
237 0.06
238 0.06
239 0.05
240 0.05
241 0.06
242 0.06
243 0.07
244 0.07
245 0.06
246 0.06
247 0.07
248 0.09
249 0.08
250 0.11
251 0.11
252 0.11
253 0.13
254 0.13
255 0.12
256 0.11
257 0.12
258 0.11
259 0.1
260 0.11
261 0.09
262 0.09
263 0.1
264 0.09
265 0.08
266 0.07
267 0.06
268 0.05
269 0.05
270 0.05
271 0.08
272 0.08
273 0.08
274 0.08
275 0.08
276 0.09
277 0.1
278 0.1
279 0.08
280 0.13
281 0.15
282 0.16
283 0.17
284 0.19
285 0.2
286 0.2
287 0.2
288 0.16
289 0.14
290 0.14
291 0.14
292 0.11
293 0.1
294 0.1
295 0.09
296 0.08
297 0.07
298 0.07
299 0.09
300 0.1
301 0.1
302 0.14
303 0.21
304 0.27
305 0.31
306 0.34
307 0.37
308 0.38
309 0.39
310 0.41
311 0.42
312 0.45
313 0.48
314 0.52
315 0.55
316 0.53
317 0.5
318 0.45
319 0.38
320 0.29
321 0.25
322 0.22
323 0.18
324 0.18
325 0.2
326 0.19
327 0.2
328 0.2
329 0.18
330 0.16
331 0.14
332 0.16
333 0.18
334 0.18
335 0.17
336 0.15
337 0.14
338 0.11
339 0.11
340 0.09
341 0.06
342 0.06
343 0.06
344 0.06
345 0.06
346 0.07
347 0.1
348 0.11
349 0.12
350 0.14
351 0.14
352 0.14
353 0.15
354 0.16
355 0.13
356 0.14
357 0.14
358 0.14
359 0.15
360 0.15
361 0.14
362 0.14
363 0.14
364 0.12
365 0.1
366 0.13
367 0.13
368 0.15
369 0.15
370 0.12
371 0.13
372 0.13
373 0.14
374 0.1
375 0.1
376 0.08
377 0.08
378 0.07
379 0.06
380 0.07
381 0.05
382 0.05
383 0.04
384 0.05
385 0.06
386 0.06
387 0.06
388 0.05
389 0.06
390 0.07
391 0.09
392 0.08
393 0.1
394 0.11
395 0.14
396 0.16
397 0.16
398 0.17
399 0.18
400 0.19
401 0.18
402 0.22
403 0.21
404 0.21
405 0.22
406 0.21
407 0.2
408 0.22
409 0.19
410 0.15
411 0.14
412 0.13
413 0.12
414 0.16
415 0.22
416 0.26
417 0.31
418 0.34
419 0.36
420 0.41
421 0.43
422 0.46
423 0.51
424 0.55
425 0.6
426 0.64
427 0.69
428 0.71
429 0.78
430 0.81
431 0.8
432 0.79
433 0.79
434 0.75
435 0.72
436 0.7
437 0.69
438 0.68
439 0.65
440 0.62
441 0.58
442 0.57
443 0.55
444 0.57
445 0.55
446 0.54
447 0.53
448 0.48
449 0.5
450 0.5
451 0.49
452 0.48
453 0.46
454 0.39
455 0.35
456 0.34
457 0.28