Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

B2WDE1

Protein Details
Accession B2WDE1    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
55-74DWESRWKPSHAKKDVKSDDEHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 8E.R. 8, extr 4, cyto_nucl 4, golg 4, cyto_pero 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR001580  Calret/calnex  
IPR018124  Calret/calnex_CS  
IPR009033  Calreticulin/calnexin_P_dom_sf  
IPR013320  ConA-like_dom_sf  
Gene Ontology GO:0005783  C:endoplasmic reticulum  
GO:0016020  C:membrane  
GO:0005509  F:calcium ion binding  
GO:0051082  F:unfolded protein binding  
GO:0006457  P:protein folding  
Pfam View protein in Pfam  
PF00262  Calreticulin  
PROSITE View protein in PROSITE  
PS00803  CALRETICULIN_1  
PS00804  CALRETICULIN_2  
PS00805  CALRETICULIN_REPEAT  
Amino Acid Sequences MRFAIGATVALAAAVVRADDASAPEAESSAASTVAKPTFTPTKLKAPFLEQFTDDWESRWKPSHAKKDVKSDDEEWAYVGTWAVEEPTVLKGMEGDKGLVIKDKAAHHAISAKFPKAINNKDNTLVVQYEVKLQDGLECGGAYMKLLQDNKALHAEEFSNASPYIIMFGPDKCGATNKVHFIFRHKNPKTGEYEEKHLNAPPMARIVKTSTLYTLIVKPDQNFEIKIDGESIRNGTLLEDFTPSVNPPEEIDDPNDKKPEDWVDDARIPDPEAKKPEDWDDDAPFEIVDEEATKPEDWLDDEPTTIPDPEAEKPEDWDDEEDGDWIPPTVPNPKCDEVSGCGKWEPPMKKNPNFRGKWAAPFIDNPAYKGEWAPRKIPNPDYFEDKTPANFEPIGAIGFELWTMQNDILFDNIYIGHSVEEAEKLKAETFDPKHAAEKAEEEATKPKPADTPKSPSDLVFKDDPLKYVQEKTKLFVEIAKRDPVEAIKFVPEVAGGVGVILVTIFAILASVLLGSGAAPSKEQVKAQAKKAKDSAVKAKDKTAEAVATGSEKAQAEVNKRTNKS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.04
2 0.04
3 0.04
4 0.04
5 0.04
6 0.05
7 0.07
8 0.09
9 0.1
10 0.1
11 0.1
12 0.11
13 0.11
14 0.1
15 0.1
16 0.08
17 0.09
18 0.09
19 0.09
20 0.14
21 0.16
22 0.16
23 0.15
24 0.21
25 0.28
26 0.3
27 0.37
28 0.36
29 0.45
30 0.5
31 0.54
32 0.51
33 0.5
34 0.53
35 0.51
36 0.5
37 0.4
38 0.36
39 0.37
40 0.39
41 0.32
42 0.27
43 0.3
44 0.28
45 0.31
46 0.36
47 0.35
48 0.4
49 0.5
50 0.59
51 0.62
52 0.69
53 0.72
54 0.77
55 0.82
56 0.77
57 0.72
58 0.64
59 0.61
60 0.54
61 0.48
62 0.37
63 0.3
64 0.25
65 0.2
66 0.17
67 0.09
68 0.07
69 0.07
70 0.07
71 0.06
72 0.06
73 0.07
74 0.08
75 0.09
76 0.09
77 0.09
78 0.1
79 0.11
80 0.14
81 0.13
82 0.13
83 0.12
84 0.13
85 0.14
86 0.16
87 0.15
88 0.14
89 0.19
90 0.2
91 0.24
92 0.26
93 0.26
94 0.23
95 0.3
96 0.29
97 0.33
98 0.35
99 0.32
100 0.32
101 0.32
102 0.39
103 0.41
104 0.48
105 0.47
106 0.49
107 0.5
108 0.49
109 0.5
110 0.43
111 0.37
112 0.28
113 0.22
114 0.19
115 0.17
116 0.2
117 0.19
118 0.19
119 0.16
120 0.16
121 0.17
122 0.15
123 0.16
124 0.11
125 0.1
126 0.09
127 0.1
128 0.09
129 0.07
130 0.07
131 0.08
132 0.12
133 0.13
134 0.14
135 0.18
136 0.19
137 0.22
138 0.24
139 0.24
140 0.19
141 0.2
142 0.19
143 0.16
144 0.18
145 0.15
146 0.14
147 0.13
148 0.13
149 0.11
150 0.1
151 0.11
152 0.09
153 0.1
154 0.09
155 0.09
156 0.13
157 0.14
158 0.14
159 0.12
160 0.15
161 0.17
162 0.21
163 0.25
164 0.27
165 0.3
166 0.33
167 0.33
168 0.39
169 0.45
170 0.48
171 0.55
172 0.51
173 0.54
174 0.54
175 0.59
176 0.58
177 0.55
178 0.55
179 0.47
180 0.51
181 0.48
182 0.47
183 0.42
184 0.37
185 0.32
186 0.24
187 0.22
188 0.18
189 0.19
190 0.18
191 0.17
192 0.17
193 0.19
194 0.22
195 0.22
196 0.22
197 0.17
198 0.18
199 0.19
200 0.19
201 0.19
202 0.17
203 0.18
204 0.19
205 0.19
206 0.2
207 0.21
208 0.2
209 0.18
210 0.17
211 0.17
212 0.15
213 0.15
214 0.14
215 0.13
216 0.13
217 0.13
218 0.12
219 0.1
220 0.1
221 0.1
222 0.08
223 0.08
224 0.08
225 0.08
226 0.08
227 0.08
228 0.08
229 0.09
230 0.09
231 0.09
232 0.09
233 0.09
234 0.08
235 0.12
236 0.14
237 0.14
238 0.17
239 0.23
240 0.25
241 0.28
242 0.3
243 0.25
244 0.23
245 0.25
246 0.26
247 0.22
248 0.23
249 0.22
250 0.24
251 0.26
252 0.27
253 0.24
254 0.2
255 0.17
256 0.19
257 0.19
258 0.19
259 0.21
260 0.23
261 0.23
262 0.24
263 0.27
264 0.26
265 0.26
266 0.25
267 0.23
268 0.21
269 0.21
270 0.19
271 0.15
272 0.11
273 0.09
274 0.06
275 0.04
276 0.04
277 0.05
278 0.05
279 0.07
280 0.07
281 0.06
282 0.07
283 0.07
284 0.08
285 0.09
286 0.12
287 0.11
288 0.11
289 0.11
290 0.13
291 0.13
292 0.12
293 0.1
294 0.08
295 0.1
296 0.12
297 0.15
298 0.15
299 0.15
300 0.16
301 0.18
302 0.17
303 0.15
304 0.15
305 0.12
306 0.11
307 0.11
308 0.1
309 0.09
310 0.08
311 0.07
312 0.06
313 0.06
314 0.05
315 0.07
316 0.15
317 0.16
318 0.19
319 0.25
320 0.26
321 0.27
322 0.27
323 0.28
324 0.23
325 0.29
326 0.27
327 0.23
328 0.21
329 0.21
330 0.23
331 0.28
332 0.29
333 0.28
334 0.38
335 0.45
336 0.52
337 0.62
338 0.69
339 0.72
340 0.69
341 0.68
342 0.67
343 0.6
344 0.59
345 0.53
346 0.45
347 0.36
348 0.35
349 0.35
350 0.33
351 0.31
352 0.26
353 0.24
354 0.23
355 0.22
356 0.22
357 0.25
358 0.25
359 0.28
360 0.32
361 0.35
362 0.4
363 0.45
364 0.5
365 0.5
366 0.49
367 0.48
368 0.51
369 0.47
370 0.45
371 0.42
372 0.36
373 0.3
374 0.27
375 0.26
376 0.21
377 0.19
378 0.15
379 0.14
380 0.14
381 0.13
382 0.09
383 0.09
384 0.06
385 0.06
386 0.05
387 0.05
388 0.04
389 0.05
390 0.06
391 0.06
392 0.07
393 0.07
394 0.08
395 0.08
396 0.08
397 0.07
398 0.07
399 0.07
400 0.07
401 0.07
402 0.07
403 0.06
404 0.06
405 0.07
406 0.07
407 0.1
408 0.11
409 0.11
410 0.12
411 0.12
412 0.13
413 0.14
414 0.14
415 0.2
416 0.22
417 0.29
418 0.31
419 0.32
420 0.34
421 0.35
422 0.36
423 0.28
424 0.28
425 0.23
426 0.26
427 0.25
428 0.23
429 0.27
430 0.28
431 0.31
432 0.28
433 0.27
434 0.28
435 0.34
436 0.41
437 0.42
438 0.48
439 0.46
440 0.52
441 0.51
442 0.46
443 0.47
444 0.4
445 0.38
446 0.32
447 0.3
448 0.32
449 0.32
450 0.32
451 0.28
452 0.31
453 0.29
454 0.34
455 0.38
456 0.4
457 0.4
458 0.42
459 0.44
460 0.41
461 0.39
462 0.36
463 0.38
464 0.37
465 0.4
466 0.43
467 0.38
468 0.37
469 0.38
470 0.37
471 0.33
472 0.28
473 0.25
474 0.22
475 0.22
476 0.22
477 0.2
478 0.15
479 0.12
480 0.1
481 0.09
482 0.05
483 0.05
484 0.05
485 0.04
486 0.04
487 0.03
488 0.03
489 0.02
490 0.02
491 0.02
492 0.02
493 0.02
494 0.02
495 0.03
496 0.03
497 0.03
498 0.03
499 0.03
500 0.03
501 0.03
502 0.05
503 0.07
504 0.07
505 0.07
506 0.09
507 0.13
508 0.16
509 0.17
510 0.26
511 0.34
512 0.41
513 0.5
514 0.57
515 0.56
516 0.61
517 0.65
518 0.64
519 0.61
520 0.61
521 0.63
522 0.65
523 0.71
524 0.65
525 0.68
526 0.64
527 0.6
528 0.55
529 0.49
530 0.4
531 0.32
532 0.31
533 0.25
534 0.21
535 0.2
536 0.17
537 0.16
538 0.15
539 0.15
540 0.19
541 0.23
542 0.27
543 0.37
544 0.46