Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

W6YET9

Protein Details
Accession W6YET9   
Localization Confidence High
Confidence Score 15
NoLS Segment(s)
PositionSequenceProtein Nature
44-73ARKPRVALACKRCKRRKQRCDGARPVCRSCHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 27
Family & Domain DBs
InterPro View protein in InterPro  
IPR036864  Zn2-C6_fun-type_DNA-bd_sf  
IPR001138  Zn2Cys6_DnaBD  
Gene Ontology GO:0005634  C:nucleus  
GO:0000981  F:DNA-binding transcription factor activity, RNA polymerase II-specific  
GO:0008270  F:zinc ion binding  
KEGG bze:COCCADRAFT_105831  -  
Pfam View protein in Pfam  
PF00172  Zn_clus  
PROSITE View protein in PROSITE  
PS00463  ZN2_CY6_FUNGAL_1  
PS50048  ZN2_CY6_FUNGAL_2  
CDD cd00067  GAL4  
Amino Acid Sequences MSQSYAESLLSPSGSADDQIPASSTTATEVPSNGTSVGAQPSAARKPRVALACKRCKRRKQRCDGARPVCRSCERAGVACAYERTLRPQYPGGKSA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.1
3 0.09
4 0.09
5 0.1
6 0.1
7 0.11
8 0.1
9 0.1
10 0.1
11 0.09
12 0.09
13 0.09
14 0.1
15 0.1
16 0.09
17 0.11
18 0.11
19 0.12
20 0.1
21 0.1
22 0.09
23 0.09
24 0.11
25 0.08
26 0.07
27 0.08
28 0.11
29 0.16
30 0.19
31 0.19
32 0.18
33 0.19
34 0.24
35 0.29
36 0.3
37 0.34
38 0.41
39 0.5
40 0.57
41 0.66
42 0.7
43 0.75
44 0.82
45 0.84
46 0.85
47 0.85
48 0.9
49 0.9
50 0.91
51 0.92
52 0.9
53 0.87
54 0.82
55 0.74
56 0.69
57 0.62
58 0.54
59 0.46
60 0.44
61 0.38
62 0.34
63 0.34
64 0.3
65 0.28
66 0.28
67 0.26
68 0.21
69 0.22
70 0.2
71 0.26
72 0.3
73 0.31
74 0.32
75 0.39
76 0.45