Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

W6YES9

Protein Details
Accession W6YES9   
Localization Confidence Medium
Confidence Score 12.3
NoLS Segment(s)
PositionSequenceProtein Nature
275-302ACANSYYRGRRDRERKCPRCRTECTGDVHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 19, cyto 4, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR011513  Nse1  
IPR014857  Nse1_RING_C4HC3-type  
IPR036388  WH-like_DNA-bd_sf  
IPR013083  Znf_RING/FYVE/PHD  
Gene Ontology GO:0005634  C:nucleus  
GO:0030915  C:Smc5-Smc6 complex  
GO:0046872  F:metal ion binding  
GO:0016740  F:transferase activity  
GO:0006310  P:DNA recombination  
GO:0006281  P:DNA repair  
KEGG bze:COCCADRAFT_8151  -  
Pfam View protein in Pfam  
PF07574  SMC_Nse1  
PF08746  zf-RING-like  
CDD cd16493  RING-CH-C4HC3_NSE1  
Amino Acid Sequences MSRSESPFVRAPIEDEGYNSIHRAFLQAFQTNGVLTVEEMKPILAHIMTAYNPNRPWTEGDVTQPYLTSTIQTINAKLETFDYEIRSMRDQQSKDVVYALVNNTSDALTQLATTFSANEIAYIRRLLDHMFEANNTSVRETMAVKHTEASQLARVSRRNRQSQFNGTSTQFNDETQDTQLQGADTSISIAEADNVLDSLVAQGFFNKSRAGYYSLAPRALMELRAYLKETYNESADENEDGREIIRIRDCEGCREIVTVGIRCNNKNCGVRWHDACANSYYRGRRDRERKCPRCRTECTGDVFVGERADRVAARTSTEGSRRSTLHARAEEEEDEDEDEDE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.29
2 0.26
3 0.27
4 0.25
5 0.26
6 0.23
7 0.18
8 0.15
9 0.15
10 0.17
11 0.15
12 0.18
13 0.24
14 0.26
15 0.26
16 0.27
17 0.27
18 0.24
19 0.23
20 0.18
21 0.12
22 0.09
23 0.14
24 0.12
25 0.13
26 0.13
27 0.12
28 0.11
29 0.11
30 0.13
31 0.07
32 0.07
33 0.07
34 0.1
35 0.11
36 0.18
37 0.19
38 0.23
39 0.24
40 0.27
41 0.28
42 0.27
43 0.31
44 0.3
45 0.33
46 0.3
47 0.34
48 0.36
49 0.37
50 0.35
51 0.31
52 0.25
53 0.22
54 0.2
55 0.15
56 0.11
57 0.11
58 0.16
59 0.17
60 0.18
61 0.19
62 0.2
63 0.19
64 0.18
65 0.17
66 0.15
67 0.16
68 0.17
69 0.17
70 0.18
71 0.2
72 0.22
73 0.23
74 0.25
75 0.3
76 0.35
77 0.33
78 0.35
79 0.41
80 0.4
81 0.37
82 0.34
83 0.27
84 0.2
85 0.22
86 0.2
87 0.15
88 0.14
89 0.14
90 0.13
91 0.13
92 0.12
93 0.09
94 0.09
95 0.06
96 0.06
97 0.06
98 0.06
99 0.06
100 0.06
101 0.06
102 0.06
103 0.08
104 0.08
105 0.08
106 0.09
107 0.09
108 0.1
109 0.1
110 0.1
111 0.08
112 0.09
113 0.09
114 0.09
115 0.1
116 0.11
117 0.11
118 0.11
119 0.12
120 0.13
121 0.14
122 0.13
123 0.12
124 0.1
125 0.1
126 0.11
127 0.1
128 0.12
129 0.15
130 0.16
131 0.15
132 0.16
133 0.17
134 0.17
135 0.17
136 0.16
137 0.14
138 0.14
139 0.16
140 0.19
141 0.23
142 0.25
143 0.32
144 0.38
145 0.44
146 0.46
147 0.51
148 0.54
149 0.58
150 0.59
151 0.54
152 0.5
153 0.42
154 0.41
155 0.34
156 0.31
157 0.23
158 0.17
159 0.17
160 0.15
161 0.15
162 0.13
163 0.14
164 0.11
165 0.1
166 0.11
167 0.09
168 0.08
169 0.07
170 0.06
171 0.04
172 0.04
173 0.04
174 0.04
175 0.04
176 0.03
177 0.04
178 0.04
179 0.04
180 0.03
181 0.03
182 0.03
183 0.03
184 0.03
185 0.03
186 0.04
187 0.04
188 0.04
189 0.05
190 0.07
191 0.08
192 0.09
193 0.09
194 0.09
195 0.1
196 0.12
197 0.16
198 0.15
199 0.16
200 0.24
201 0.25
202 0.25
203 0.24
204 0.22
205 0.2
206 0.2
207 0.19
208 0.11
209 0.12
210 0.13
211 0.14
212 0.16
213 0.14
214 0.15
215 0.16
216 0.19
217 0.18
218 0.18
219 0.18
220 0.16
221 0.17
222 0.16
223 0.15
224 0.13
225 0.11
226 0.1
227 0.09
228 0.09
229 0.1
230 0.1
231 0.12
232 0.15
233 0.16
234 0.18
235 0.26
236 0.27
237 0.3
238 0.31
239 0.29
240 0.26
241 0.26
242 0.24
243 0.2
244 0.22
245 0.19
246 0.19
247 0.23
248 0.25
249 0.26
250 0.3
251 0.31
252 0.35
253 0.38
254 0.38
255 0.41
256 0.45
257 0.49
258 0.49
259 0.5
260 0.48
261 0.45
262 0.45
263 0.4
264 0.36
265 0.33
266 0.36
267 0.35
268 0.38
269 0.44
270 0.47
271 0.53
272 0.61
273 0.68
274 0.74
275 0.8
276 0.83
277 0.86
278 0.92
279 0.91
280 0.9
281 0.88
282 0.85
283 0.83
284 0.79
285 0.75
286 0.67
287 0.57
288 0.49
289 0.42
290 0.35
291 0.28
292 0.21
293 0.15
294 0.12
295 0.13
296 0.13
297 0.13
298 0.19
299 0.17
300 0.2
301 0.22
302 0.25
303 0.29
304 0.35
305 0.36
306 0.34
307 0.38
308 0.37
309 0.41
310 0.46
311 0.47
312 0.5
313 0.52
314 0.51
315 0.5
316 0.53
317 0.48
318 0.42
319 0.37
320 0.29
321 0.25