Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

W6YAA6

Protein Details
Accession W6YAA6    Localization Confidence Low Confidence Score 7.5
NoLS Segment(s)
PositionSequenceProtein Nature
63-83NYPWNNCKWKRECNNGHPENCHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 13, nucl 8.5, cyto_nucl 7.5, cyto 5.5
Family & Domain DBs
KEGG bze:COCCADRAFT_35840  -  
Amino Acid Sequences MKLNACASSYKYCACSDNDTNNGFDYAATKSNCTSIKTRYLRWFHENNGVKGRYYCKTLDSSNYPWNNCKWKRECNNGHPENCWGKVHW
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.3
2 0.34
3 0.34
4 0.39
5 0.42
6 0.4
7 0.4
8 0.37
9 0.34
10 0.27
11 0.2
12 0.15
13 0.12
14 0.16
15 0.16
16 0.15
17 0.15
18 0.2
19 0.22
20 0.23
21 0.23
22 0.22
23 0.32
24 0.34
25 0.39
26 0.43
27 0.46
28 0.48
29 0.5
30 0.49
31 0.42
32 0.48
33 0.48
34 0.41
35 0.43
36 0.39
37 0.34
38 0.33
39 0.34
40 0.26
41 0.25
42 0.23
43 0.19
44 0.22
45 0.23
46 0.27
47 0.29
48 0.33
49 0.38
50 0.42
51 0.42
52 0.41
53 0.45
54 0.51
55 0.49
56 0.54
57 0.52
58 0.58
59 0.66
60 0.74
61 0.78
62 0.77
63 0.84
64 0.82
65 0.78
66 0.7
67 0.69
68 0.64
69 0.57