Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

W6Y316

Protein Details
Accession W6Y316   
Localization Confidence High
Confidence Score 15.9
NoLS Segment(s)
PositionSequenceProtein Nature
256-280EDSAPTTRRTNRAKPKPAPKRTRKRBasic
NLS Segment(s)
PositionSequence
210-213RAAK
263-280RRTNRAKPKPAPKRTRKR
Subcellular Location(s) nucl 22.5, cyto_nucl 12.5, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR012423  Eaf7/MRGBP  
Gene Ontology GO:0043189  C:H4/H2A histone acetyltransferase complex  
GO:0005634  C:nucleus  
GO:0006355  P:regulation of DNA-templated transcription  
KEGG bze:COCCADRAFT_40131  -  
Pfam View protein in Pfam  
PF07904  Eaf7  
Amino Acid Sequences MPPRKKAKASAASTPLGDTQPKTPQDSGAAQAQDEILSDPWADEQETQLLKSMMKWKPTGLHKHFRMISIHTDMRSHGFAGEDAPHTRIPGIWKKLSQWYDLDALDTRENEFAFSDEPDPLDPDDAANLPEFELPEEEFGEMMWRKRFHSPDSVVASSPPMVPTDEYKDIYAPGIGLLKDLPDGVRSQKAESVTEATSTPKNTKGTRPARAAKSVKSSRSAANSARNAKPRSTVSESAEEEDEDEDEEESSVESEEDSAPTTRRTNRAKPKPAPKRTRKR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.51
2 0.43
3 0.35
4 0.32
5 0.25
6 0.24
7 0.3
8 0.33
9 0.37
10 0.35
11 0.35
12 0.38
13 0.38
14 0.36
15 0.34
16 0.32
17 0.26
18 0.26
19 0.24
20 0.18
21 0.16
22 0.15
23 0.09
24 0.09
25 0.09
26 0.08
27 0.09
28 0.1
29 0.1
30 0.09
31 0.1
32 0.15
33 0.16
34 0.16
35 0.18
36 0.18
37 0.17
38 0.21
39 0.29
40 0.27
41 0.31
42 0.32
43 0.31
44 0.38
45 0.46
46 0.53
47 0.52
48 0.58
49 0.56
50 0.64
51 0.63
52 0.58
53 0.53
54 0.45
55 0.43
56 0.39
57 0.39
58 0.31
59 0.3
60 0.28
61 0.28
62 0.25
63 0.2
64 0.14
65 0.12
66 0.11
67 0.12
68 0.14
69 0.13
70 0.13
71 0.15
72 0.15
73 0.14
74 0.14
75 0.14
76 0.18
77 0.24
78 0.29
79 0.31
80 0.32
81 0.35
82 0.43
83 0.43
84 0.39
85 0.32
86 0.28
87 0.28
88 0.27
89 0.25
90 0.18
91 0.18
92 0.17
93 0.16
94 0.14
95 0.12
96 0.12
97 0.11
98 0.1
99 0.09
100 0.08
101 0.09
102 0.09
103 0.08
104 0.09
105 0.09
106 0.1
107 0.09
108 0.09
109 0.08
110 0.06
111 0.07
112 0.07
113 0.07
114 0.06
115 0.06
116 0.06
117 0.06
118 0.06
119 0.06
120 0.06
121 0.06
122 0.07
123 0.07
124 0.06
125 0.06
126 0.05
127 0.08
128 0.09
129 0.1
130 0.13
131 0.14
132 0.16
133 0.22
134 0.24
135 0.24
136 0.31
137 0.32
138 0.36
139 0.4
140 0.39
141 0.34
142 0.32
143 0.29
144 0.22
145 0.19
146 0.13
147 0.08
148 0.08
149 0.08
150 0.1
151 0.15
152 0.18
153 0.18
154 0.18
155 0.18
156 0.18
157 0.17
158 0.15
159 0.09
160 0.07
161 0.08
162 0.07
163 0.07
164 0.07
165 0.07
166 0.07
167 0.07
168 0.06
169 0.05
170 0.07
171 0.09
172 0.14
173 0.15
174 0.16
175 0.19
176 0.2
177 0.2
178 0.21
179 0.21
180 0.17
181 0.17
182 0.16
183 0.16
184 0.17
185 0.18
186 0.19
187 0.21
188 0.25
189 0.27
190 0.34
191 0.42
192 0.48
193 0.54
194 0.6
195 0.63
196 0.63
197 0.7
198 0.66
199 0.61
200 0.63
201 0.62
202 0.57
203 0.53
204 0.51
205 0.46
206 0.48
207 0.48
208 0.42
209 0.45
210 0.49
211 0.51
212 0.55
213 0.59
214 0.56
215 0.53
216 0.54
217 0.48
218 0.49
219 0.5
220 0.48
221 0.45
222 0.5
223 0.5
224 0.46
225 0.44
226 0.35
227 0.28
228 0.24
229 0.19
230 0.12
231 0.11
232 0.09
233 0.08
234 0.08
235 0.07
236 0.07
237 0.07
238 0.07
239 0.06
240 0.06
241 0.07
242 0.08
243 0.08
244 0.1
245 0.12
246 0.13
247 0.17
248 0.23
249 0.28
250 0.36
251 0.44
252 0.53
253 0.62
254 0.72
255 0.79
256 0.83
257 0.88
258 0.9
259 0.93
260 0.94