Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

W6Y9I7

Protein Details
Accession W6Y9I7   
Localization Confidence Medium
Confidence Score 13.9
NoLS Segment(s)
PositionSequenceProtein Nature
8-28IEPPAVKKRGRPKKAAAEDAGHydrophilic
NLS Segment(s)
PositionSequence
14-22KKRGRPKKA
62-62K
Subcellular Location(s) nucl 12, mito 8.5, cyto_mito 6.5, cyto 3.5
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
KEGG bze:COCCADRAFT_25651  -  
Amino Acid Sequences MSSTNTIIEPPAVKKRGRPKKAAAEDAGETIVADAKKTSAVKKATTKSIAPRDKFVAPEKDKKTIAKKNAPEHPTPVTAATSKILESVRAKGTLSKTLPTKAANLESRSSATPPTTKPATATTAQAPPQSQPKPPRAHPTPTTIPLPQKPIPAPSPISSTSHTTSPRNPVLPPNPYPSTPRRIPPALSQHTRVIEPTPDIRLPPKYKPAARRVTAIIVSLPIVLVFGYELIERWRGKKEVKVKFGGERGM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.42
2 0.52
3 0.6
4 0.65
5 0.68
6 0.68
7 0.75
8 0.82
9 0.82
10 0.74
11 0.68
12 0.61
13 0.54
14 0.44
15 0.33
16 0.23
17 0.16
18 0.16
19 0.11
20 0.1
21 0.09
22 0.09
23 0.14
24 0.16
25 0.19
26 0.23
27 0.27
28 0.33
29 0.42
30 0.47
31 0.5
32 0.52
33 0.53
34 0.55
35 0.62
36 0.64
37 0.57
38 0.56
39 0.53
40 0.51
41 0.51
42 0.48
43 0.48
44 0.45
45 0.53
46 0.53
47 0.55
48 0.55
49 0.57
50 0.6
51 0.59
52 0.62
53 0.62
54 0.66
55 0.67
56 0.74
57 0.72
58 0.65
59 0.6
60 0.54
61 0.46
62 0.4
63 0.32
64 0.25
65 0.21
66 0.2
67 0.17
68 0.14
69 0.12
70 0.13
71 0.12
72 0.14
73 0.15
74 0.18
75 0.19
76 0.19
77 0.19
78 0.21
79 0.23
80 0.27
81 0.26
82 0.26
83 0.26
84 0.27
85 0.29
86 0.26
87 0.26
88 0.21
89 0.26
90 0.26
91 0.26
92 0.25
93 0.24
94 0.25
95 0.23
96 0.21
97 0.17
98 0.14
99 0.15
100 0.15
101 0.19
102 0.18
103 0.17
104 0.18
105 0.19
106 0.21
107 0.19
108 0.2
109 0.18
110 0.2
111 0.21
112 0.21
113 0.19
114 0.17
115 0.23
116 0.23
117 0.26
118 0.29
119 0.36
120 0.4
121 0.43
122 0.51
123 0.49
124 0.54
125 0.51
126 0.53
127 0.49
128 0.47
129 0.46
130 0.4
131 0.39
132 0.35
133 0.39
134 0.34
135 0.33
136 0.31
137 0.32
138 0.31
139 0.3
140 0.3
141 0.25
142 0.27
143 0.25
144 0.27
145 0.24
146 0.26
147 0.25
148 0.26
149 0.28
150 0.26
151 0.29
152 0.33
153 0.36
154 0.33
155 0.33
156 0.36
157 0.4
158 0.43
159 0.43
160 0.42
161 0.41
162 0.4
163 0.45
164 0.42
165 0.43
166 0.41
167 0.41
168 0.41
169 0.42
170 0.43
171 0.46
172 0.51
173 0.52
174 0.52
175 0.52
176 0.5
177 0.49
178 0.47
179 0.4
180 0.32
181 0.25
182 0.25
183 0.23
184 0.23
185 0.22
186 0.23
187 0.26
188 0.33
189 0.35
190 0.38
191 0.45
192 0.49
193 0.55
194 0.62
195 0.68
196 0.69
197 0.67
198 0.65
199 0.59
200 0.57
201 0.51
202 0.43
203 0.34
204 0.24
205 0.22
206 0.18
207 0.14
208 0.08
209 0.07
210 0.05
211 0.05
212 0.04
213 0.04
214 0.05
215 0.05
216 0.06
217 0.08
218 0.14
219 0.16
220 0.19
221 0.25
222 0.29
223 0.34
224 0.42
225 0.5
226 0.55
227 0.61
228 0.65
229 0.63
230 0.66