Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

W6XIH1

Protein Details
Accession W6XIH1   
Localization Confidence Medium
Confidence Score 14
NoLS Segment(s)
PositionSequenceProtein Nature
28-49ASNKAASEHKSRKRKRIQEGGDHydrophilic
73-103REGKARTAASKQRKRHCKRYGETRHNSRACEBasic
NLS Segment(s)
PositionSequence
32-43AASEHKSRKRKR
Subcellular Location(s) nucl 19.5, cyto_nucl 12.833, mito_nucl 12.166, cyto 4
Family & Domain DBs
KEGG bze:COCCADRAFT_31459  -  
Amino Acid Sequences MFDQLGKGTEMILHSQTLLAARVLQPKASNKAASEHKSRKRKRIQEGGDLSKEQAEDLTAELNVRAQVDEATREGKARTAASKQRKRHCKRYGETRHNSRACEKEIIEVND
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.12
3 0.13
4 0.12
5 0.11
6 0.09
7 0.09
8 0.12
9 0.19
10 0.19
11 0.2
12 0.23
13 0.27
14 0.32
15 0.34
16 0.33
17 0.27
18 0.33
19 0.39
20 0.4
21 0.45
22 0.49
23 0.55
24 0.64
25 0.69
26 0.73
27 0.76
28 0.8
29 0.8
30 0.81
31 0.77
32 0.77
33 0.78
34 0.73
35 0.65
36 0.56
37 0.46
38 0.37
39 0.31
40 0.21
41 0.13
42 0.08
43 0.05
44 0.05
45 0.06
46 0.04
47 0.05
48 0.05
49 0.05
50 0.05
51 0.05
52 0.05
53 0.05
54 0.06
55 0.07
56 0.08
57 0.09
58 0.1
59 0.1
60 0.11
61 0.11
62 0.12
63 0.14
64 0.14
65 0.17
66 0.23
67 0.32
68 0.43
69 0.52
70 0.59
71 0.66
72 0.76
73 0.81
74 0.84
75 0.85
76 0.84
77 0.84
78 0.86
79 0.88
80 0.88
81 0.89
82 0.88
83 0.89
84 0.82
85 0.76
86 0.72
87 0.68
88 0.61
89 0.57
90 0.48
91 0.45