Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

W6XJC0

Protein Details
Accession W6XJC0    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
44-66FGSRSREKEKKDREREQRMFRALBasic
NLS Segment(s)
Subcellular Location(s) mito 21, plas 3, cyto 2
Family & Domain DBs
KEGG bze:COCCADRAFT_111867  -  
bze:COCCADRAFT_41994  -  
Amino Acid Sequences MARASRCFRRRIMLPVCDWFQGAAGRLWGTLRVWLAGLSCLVCFGSRSREKEKKDREREQRMFRALLWDFNNSKRVMAQLVPTLSRSGSMPRSR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.55
2 0.56
3 0.55
4 0.48
5 0.43
6 0.33
7 0.26
8 0.21
9 0.18
10 0.13
11 0.11
12 0.11
13 0.11
14 0.11
15 0.1
16 0.09
17 0.1
18 0.09
19 0.09
20 0.09
21 0.09
22 0.09
23 0.08
24 0.08
25 0.06
26 0.06
27 0.05
28 0.05
29 0.05
30 0.05
31 0.06
32 0.14
33 0.18
34 0.23
35 0.31
36 0.39
37 0.44
38 0.53
39 0.63
40 0.66
41 0.71
42 0.77
43 0.79
44 0.82
45 0.86
46 0.85
47 0.82
48 0.74
49 0.66
50 0.56
51 0.53
52 0.43
53 0.4
54 0.33
55 0.31
56 0.29
57 0.31
58 0.35
59 0.28
60 0.28
61 0.23
62 0.22
63 0.2
64 0.2
65 0.2
66 0.21
67 0.24
68 0.24
69 0.25
70 0.24
71 0.22
72 0.21
73 0.19
74 0.19